BLASTX nr result
ID: Panax24_contig00013681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013681 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006485864.2 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-07 KDO42602.1 hypothetical protein CISIN_1g044775mg [Citrus sinensis] 60 1e-07 XP_006436291.1 hypothetical protein CICLE_v10033724mg, partial [... 60 1e-07 KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] 57 9e-07 JAU07629.1 Putative pentatricopeptide repeat-containing protein,... 55 9e-07 XP_015570529.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 9e-07 XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 9e-07 XP_010101198.1 hypothetical protein L484_015002 [Morus notabilis... 57 1e-06 XP_006382364.1 hypothetical protein POPTR_0005s01450g, partial [... 57 1e-06 XP_011038961.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-06 XP_010042495.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 2e-06 JAU92355.1 Putative pentatricopeptide repeat-containing protein ... 55 2e-06 XP_013458572.1 AFG1-family ATPase [Medicago truncatula] KEH32603... 56 2e-06 XP_018484554.1 PREDICTED: lactation elevated protein 1-like isof... 56 2e-06 XP_018484553.1 PREDICTED: lactation elevated protein 1-like isof... 56 2e-06 XP_006433563.1 hypothetical protein CICLE_v10000386mg [Citrus cl... 56 2e-06 KDO81630.1 hypothetical protein CISIN_1g003746mg [Citrus sinensis] 56 2e-06 XP_006472234.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 2e-06 XP_010661013.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 3e-06 CBI39619.3 unnamed protein product, partial [Vitis vinifera] 56 3e-06 >XP_006485864.2 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Citrus sinensis] Length = 482 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 254 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 288 >KDO42602.1 hypothetical protein CISIN_1g044775mg [Citrus sinensis] Length = 552 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 345 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 379 >XP_006436291.1 hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] ESR49531.1 hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] Length = 580 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 352 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 386 >KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] Length = 641 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG+L EAE LIESMPM D STWG+LLGA Sbjct: 413 VDLLGRAGKLKEAEELIESMPMAPDVSTWGALLGA 447 >JAU07629.1 Putative pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 123 Score = 54.7 bits (130), Expect = 9e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 83 DVNNCDVKTIDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 D+ NC +DLLGRAG++ EA L+E+MP K D STWG++LGA Sbjct: 12 DIYNC---VVDLLGRAGKIGEAYELVETMPFKPDESTWGAILGA 52 >XP_015570529.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ricinus communis] Length = 797 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIE+MPM DASTWG+LLGA Sbjct: 569 VDLLGRAGMLKEAEELIENMPMAPDASTWGALLGA 603 >XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024145.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024147.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] Length = 797 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG+L EAE LIESMPM D STWG+LLGA Sbjct: 569 VDLLGRAGKLKEAEELIESMPMAPDVSTWGALLGA 603 >XP_010101198.1 hypothetical protein L484_015002 [Morus notabilis] EXB87872.1 hypothetical protein L484_015002 [Morus notabilis] Length = 483 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLL R+GQLSEAE LIESMP++ DAS WGSLLGA Sbjct: 255 VDLLSRSGQLSEAEKLIESMPVEPDASIWGSLLGA 289 >XP_006382364.1 hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] ERP60161.1 hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] Length = 788 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIESMPM D STWG+LLGA Sbjct: 560 VDLLGRAGMLKEAEELIESMPMAPDVSTWGALLGA 594 >XP_011038961.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] XP_011038962.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] XP_011038963.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] XP_011038964.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] XP_011038965.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] XP_011038966.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Populus euphratica] Length = 793 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIESMPM D STWG+LLGA Sbjct: 565 VDLLGRAGMLKEAEELIESMPMAPDVSTWGALLGA 599 >XP_010042495.1 PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Eucalyptus grandis] XP_010042496.1 PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Eucalyptus grandis] Length = 300 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG+L EA+ LIESMP+KAD++ WG+LLGA Sbjct: 73 VDLLGRAGRLDEAKKLIESMPIKADSTVWGALLGA 107 >JAU92355.1 Putative pentatricopeptide repeat-containing protein [Noccaea caerulescens] Length = 164 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 83 DVNNCDVKTIDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 D+ NC +DLLGRAG++ EA L+E+MP K D STWG++LGA Sbjct: 12 DIYNC---VVDLLGRAGKIGEAYELVETMPFKPDESTWGAILGA 52 >XP_013458572.1 AFG1-family ATPase [Medicago truncatula] KEH32603.1 AFG1-family ATPase [Medicago truncatula] Length = 400 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 295 GANGGAYFPFEELCDKPHGAADYFGLLS 212 GANG AYFPFEELCDKP GAADYFGL S Sbjct: 350 GANGCAYFPFEELCDKPLGAADYFGLFS 377 >XP_018484554.1 PREDICTED: lactation elevated protein 1-like isoform X2 [Raphanus sativus] Length = 499 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 307 LQLEGANGGAYFPFEELCDKPHGAADYFGL 218 LQ+ GANG AYFPFEELCD+P GAADYFGL Sbjct: 352 LQVLGANGCAYFPFEELCDRPLGAADYFGL 381 >XP_018484553.1 PREDICTED: lactation elevated protein 1-like isoform X1 [Raphanus sativus] Length = 500 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 307 LQLEGANGGAYFPFEELCDKPHGAADYFGL 218 LQ+ GANG AYFPFEELCD+P GAADYFGL Sbjct: 353 LQVLGANGCAYFPFEELCDRPLGAADYFGL 382 >XP_006433563.1 hypothetical protein CICLE_v10000386mg [Citrus clementina] ESR46803.1 hypothetical protein CICLE_v10000386mg [Citrus clementina] Length = 746 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIESMPM D +TWG+LLGA Sbjct: 518 VDLLGRAGMLKEAEELIESMPMSPDVATWGALLGA 552 >KDO81630.1 hypothetical protein CISIN_1g003746mg [Citrus sinensis] Length = 798 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIESMPM D +TWG+LLGA Sbjct: 570 VDLLGRAGMLKEAEELIESMPMSPDVATWGALLGA 604 >XP_006472234.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Citrus sinensis] Length = 798 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L EAE LIESMPM D +TWG+LLGA Sbjct: 570 VDLLGRAGMLKEAEELIESMPMSPDVATWGALLGA 604 >XP_010661013.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Vitis vinifera] Length = 503 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAGQLSEA LIE+MP++ DAS WGSLLGA Sbjct: 275 VDLLGRAGQLSEAVDLIENMPVEPDASIWGSLLGA 309 >CBI39619.3 unnamed protein product, partial [Vitis vinifera] Length = 640 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 110 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 214 +DLLGRAG L+EAE LIESMPM D +TWG+LLGA Sbjct: 412 VDLLGRAGLLNEAEKLIESMPMAPDVATWGALLGA 446