BLASTX nr result
ID: Panax24_contig00013553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013553 (758 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM98381.1 hypothetical protein DCAR_014257 [Daucus carota subsp... 100 1e-20 XP_017247227.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Daucu... 100 1e-20 XP_016497786.1 PREDICTED: E3 ubiquitin-protein ligase RKP-like [... 89 2e-17 KDO59932.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] 89 2e-16 XP_009603154.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicot... 89 2e-16 XP_019247940.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicot... 88 3e-16 XP_012075216.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 88 3e-16 XP_009786818.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicot... 88 3e-16 XP_010319779.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 88 3e-16 XP_010319777.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 88 3e-16 XP_012075215.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 88 4e-16 EEF33711.1 protein binding protein, putative [Ricinus communis] 87 8e-16 XP_011021928.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Popul... 87 1e-15 XP_015073582.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 87 1e-15 XP_015073581.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 87 1e-15 XP_018850120.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Jugla... 86 2e-15 XP_010261124.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 86 2e-15 XP_010261123.1 PREDICTED: E3 ubiquitin-protein ligase RKP isofor... 86 2e-15 KDO59930.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] 86 2e-15 KDO59931.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] 86 2e-15 >KZM98381.1 hypothetical protein DCAR_014257 [Daucus carota subsp. sativus] Length = 1181 Score = 100 bits (250), Expect = 1e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPLAGIILNLFD SMNTK NDI GIFASMDCPDTV+CGFQYL+EY+W ++ Sbjct: 1031 GMILAPLAGIILNLFDTSMNTKDNDIAGIFASMDCPDTVVCGFQYLIEYDWAAS 1084 >XP_017247227.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Daucus carota subsp. sativus] XP_017247228.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Daucus carota subsp. sativus] XP_017247229.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Daucus carota subsp. sativus] Length = 1273 Score = 100 bits (250), Expect = 1e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPLAGIILNLFD SMNTK NDI GIFASMDCPDTV+CGFQYL+EY+W ++ Sbjct: 1123 GMILAPLAGIILNLFDTSMNTKDNDIAGIFASMDCPDTVVCGFQYLIEYDWAAS 1176 >XP_016497786.1 PREDICTED: E3 ubiquitin-protein ligase RKP-like [Nicotiana tabacum] Length = 250 Score = 88.6 bits (218), Expect = 2e-17 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMN--TKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL DAS + T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 98 GMILAPLAGIILNLMDASRDSETGQNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 152 >KDO59932.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] Length = 1178 Score = 88.6 bits (218), Expect = 2e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 3/56 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPL GIILNL DAS ++ ND+VG+F+SMDCPDT+ CGFQYLLEYNWVS Sbjct: 1120 GMILAPLVGIILNLLDASAESECGVQNDVVGVFSSMDCPDTIHCGFQYLLEYNWVS 1175 >XP_009603154.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana tomentosiformis] Length = 1274 Score = 88.6 bits (218), Expect = 2e-16 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMN--TKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL DAS + T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1122 GMILAPLAGIILNLMDASRDSETGQNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1176 >XP_019247940.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana attenuata] XP_019247941.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana attenuata] XP_019247942.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana attenuata] XP_019247943.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana attenuata] OIT02606.1 e3 ubiquitin-protein ligase rkp [Nicotiana attenuata] Length = 1274 Score = 88.2 bits (217), Expect = 3e-16 Identities = 44/55 (80%), Positives = 46/55 (83%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMN--TKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL DAS T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1122 GMILAPLAGIILNLIDASRESETGQNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1176 >XP_012075216.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X2 [Jatropha curcas] Length = 1274 Score = 88.2 bits (217), Expect = 3e-16 Identities = 42/57 (73%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPL GIILNL DASM T+ ND+VG FASMDCPDT+ CGFQYLLEYNW + Sbjct: 1123 GMILAPLMGIILNLLDASMKTEFIEQNDVVGTFASMDCPDTMHCGFQYLLEYNWAGS 1179 >XP_009786818.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Nicotiana sylvestris] Length = 1274 Score = 88.2 bits (217), Expect = 3e-16 Identities = 44/55 (80%), Positives = 46/55 (83%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMN--TKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL DAS T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1122 GMILAPLAGIILNLIDASREPETGQNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1176 >XP_010319779.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X2 [Solanum lycopersicum] Length = 1287 Score = 88.2 bits (217), Expect = 3e-16 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDAS--MNTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL +AS +T+ ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1126 GMILAPLAGIILNLLEASGESDTRDNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1180 >XP_010319777.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X1 [Solanum lycopersicum] XP_010319778.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X1 [Solanum lycopersicum] Length = 1292 Score = 88.2 bits (217), Expect = 3e-16 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDAS--MNTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL +AS +T+ ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1131 GMILAPLAGIILNLLEASGESDTRDNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1185 >XP_012075215.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X1 [Jatropha curcas] KDP35234.1 hypothetical protein JCGZ_09393 [Jatropha curcas] Length = 1275 Score = 87.8 bits (216), Expect = 4e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNW 560 GMILAPL GIILNL DASM T+ ND+VG FASMDCPDT+ CGFQYLLEYNW Sbjct: 1123 GMILAPLMGIILNLLDASMKTEFIEQNDVVGTFASMDCPDTMHCGFQYLLEYNW 1176 >EEF33711.1 protein binding protein, putative [Ricinus communis] Length = 1348 Score = 87.0 bits (214), Expect = 8e-16 Identities = 40/55 (72%), Positives = 46/55 (83%), Gaps = 3/55 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWV 557 GMILAPL G+ILNL DAS+ + ND+VG+FASMDCPDT+ CGFQYLLEYNWV Sbjct: 1125 GMILAPLVGVILNLLDASVEMECGEQNDVVGVFASMDCPDTMHCGFQYLLEYNWV 1179 >XP_011021928.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Populus euphratica] XP_011021929.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Populus euphratica] Length = 1278 Score = 86.7 bits (213), Expect = 1e-15 Identities = 40/57 (70%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPL GI+LNL DAS+ + ND+VG+FASMDCPDTV CGFQYLLEYNW + Sbjct: 1125 GMILAPLVGILLNLLDASVEMECGERNDVVGVFASMDCPDTVHCGFQYLLEYNWAGS 1181 >XP_015073582.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X2 [Solanum pennellii] Length = 1287 Score = 86.7 bits (213), Expect = 1e-15 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASM--NTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL +AS +T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1126 GMILAPLAGIILNLLEASRESDTGDNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1180 >XP_015073581.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X1 [Solanum pennellii] Length = 1292 Score = 86.7 bits (213), Expect = 1e-15 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASM--NTKHNDIVGIFASMDCPDTVLCGFQYLLEYNWVS 554 GMILAPLAGIILNL +AS +T ND+VGIFASMDCPDTV+ GFQYLLEYNW S Sbjct: 1131 GMILAPLAGIILNLLEASRESDTGDNDMVGIFASMDCPDTVVSGFQYLLEYNWAS 1185 >XP_018850120.1 PREDICTED: E3 ubiquitin-protein ligase RKP [Juglans regia] Length = 1275 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/57 (70%), Positives = 45/57 (78%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPL GIILNL DAS + HND+VG+FASMDCP TV CGFQYLL+YNW + Sbjct: 1123 GMILAPLVGIILNLLDASSGAECREHNDVVGVFASMDCPKTVHCGFQYLLDYNWAGS 1179 >XP_010261124.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X2 [Nelumbo nucifera] Length = 1280 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTKH---NDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GM+LAPL GIILNL DAS++++ ND+VG+FASMDCP TV CGFQYLLEYNWV + Sbjct: 1124 GMVLAPLVGIILNLLDASIHSEDRVKNDVVGVFASMDCPATVHCGFQYLLEYNWVGS 1180 >XP_010261123.1 PREDICTED: E3 ubiquitin-protein ligase RKP isoform X1 [Nelumbo nucifera] Length = 1281 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTKH---NDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GM+LAPL GIILNL DAS++++ ND+VG+FASMDCP TV CGFQYLLEYNWV + Sbjct: 1125 GMVLAPLVGIILNLLDASIHSEDRVKNDVVGVFASMDCPATVHCGFQYLLEYNWVGS 1181 >KDO59930.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] Length = 1245 Score = 85.9 bits (211), Expect = 2e-15 Identities = 39/57 (68%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPL GIILNL DAS ++ ND+VG+F+SMDCPDT+ CGFQYLLEYNW + Sbjct: 1092 GMILAPLVGIILNLLDASAESECGVQNDVVGVFSSMDCPDTIHCGFQYLLEYNWAGS 1148 >KDO59931.1 hypothetical protein CISIN_1g000809mg [Citrus sinensis] Length = 1273 Score = 85.9 bits (211), Expect = 2e-15 Identities = 39/57 (68%), Positives = 46/57 (80%), Gaps = 3/57 (5%) Frame = -2 Query: 712 GMILAPLAGIILNLFDASMNTK---HNDIVGIFASMDCPDTVLCGFQYLLEYNWVSA 551 GMILAPL GIILNL DAS ++ ND+VG+F+SMDCPDT+ CGFQYLLEYNW + Sbjct: 1120 GMILAPLVGIILNLLDASAESECGVQNDVVGVFSSMDCPDTIHCGFQYLLEYNWAGS 1176