BLASTX nr result
ID: Panax24_contig00013345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013345 (943 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019463008.1 PREDICTED: calcineurin subunit B-like [Lupinus an... 57 9e-07 AFK38304.1 unknown [Lotus japonicus] 54 9e-06 >XP_019463008.1 PREDICTED: calcineurin subunit B-like [Lupinus angustifolius] Length = 100 Score = 56.6 bits (135), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 104 VLFFAQQVLTHVLEEAGYNKDSFLVLSDFMKIL 6 V + Q+VLT VLEEAGYNKDSFLVLSDFMKIL Sbjct: 54 VFYLVQEVLTQVLEEAGYNKDSFLVLSDFMKIL 86 >AFK38304.1 unknown [Lotus japonicus] Length = 106 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 92 AQQVLTHVLEEAGYNKDSFLVLSDFMKILG 3 +Q+VLT VLEEAGY KDSFLVLSDFMKILG Sbjct: 64 SQEVLTKVLEEAGYKKDSFLVLSDFMKILG 93