BLASTX nr result
ID: Panax24_contig00013025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013025 (668 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV77603.1 zf-RING_2 domain-containing protein/zf-RING_3 domain-... 57 3e-06 XP_010108122.1 E3 ubiquitin-protein ligase [Morus notabilis] EXC... 55 4e-06 >GAV77603.1 zf-RING_2 domain-containing protein/zf-RING_3 domain-containing protein [Cephalotus follicularis] Length = 221 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/98 (33%), Positives = 47/98 (47%) Frame = -3 Query: 318 ARELMPFLIQTPEILAQTKPKLSVHFRHFEKIRSPVKIEVFDGELELCMCSICGSRVLTE 139 +R L P L +T L Q P F+ + + D E + +C+IC + L + Sbjct: 69 SRPLQPHLTETSG-LNQDTPSSIPSFK--------ITSSLLDQEDPVILCAICKEQFLLD 119 Query: 138 TVVAKLPCLHLFHRDCIYQSLPNFNSCPLCGLACATFI 25 +V +LPC HL+H DCI L NSCPLC T + Sbjct: 120 AIVKRLPCNHLYHSDCITPWLHLHNSCPLCRSKIPTLV 157 >XP_010108122.1 E3 ubiquitin-protein ligase [Morus notabilis] EXC17854.1 E3 ubiquitin-protein ligase [Morus notabilis] Length = 129 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = -3 Query: 195 DGELELCMCSICGSRVLTETVVAKLPCLHLFHRDCIYQSLPNFNSCPLC 49 D E +L C IC V+ + + ++PC H FH DCI Q L NSCPLC Sbjct: 63 DDESKLMTCGICTEEVMIGSQLIRMPCSHQFHEDCILQWLNKANSCPLC 111