BLASTX nr result
ID: Panax24_contig00013023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013023 (786 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONM31625.1 ATP-citrate synthase beta chain protein 2 [Zea mays] 187 6e-57 BAD93838.1 ATP-citrate lyase subunit B, partial [Arabidopsis tha... 188 1e-56 NP_001168033.1 uncharacterized protein LOC100381760 [Zea mays] A... 187 5e-56 XP_016715895.1 PREDICTED: ATP-citrate synthase beta chain protei... 189 4e-55 XP_016724288.1 PREDICTED: ATP-citrate synthase beta chain protei... 187 1e-54 XP_012483153.1 PREDICTED: ATP-citrate synthase beta chain protei... 187 2e-54 XP_019576241.1 PREDICTED: ATP-citrate synthase beta chain protei... 189 2e-54 KDO71941.1 hypothetical protein CISIN_1g007327mg [Citrus sinensis] 187 2e-53 ONM31628.1 ATP-citrate synthase beta chain protein 2 [Zea mays] 187 3e-53 XP_010464245.1 PREDICTED: ATP-citrate synthase beta chain protei... 190 5e-53 NP_187317.1 ATP-citrate lyase B-1 [Arabidopsis thaliana] NP_0013... 190 5e-53 XP_006407923.1 hypothetical protein EUTSA_v10020323mg [Eutrema s... 190 5e-53 XP_006297252.1 hypothetical protein CARUB_v10013256mg [Capsella ... 190 5e-53 XP_019576302.1 PREDICTED: ATP-citrate synthase beta chain protei... 189 1e-52 XP_002884600.1 ATP-citrate lyase B-1 [Arabidopsis lyrata subsp. ... 189 1e-52 XP_016454812.1 PREDICTED: ATP-citrate synthase beta chain protei... 187 1e-52 XP_009789291.1 PREDICTED: ATP-citrate synthase beta chain protei... 187 1e-52 XP_018858095.1 PREDICTED: ATP-citrate synthase beta chain protei... 189 1e-52 OAY56132.1 hypothetical protein MANES_03G205000 [Manihot esculen... 189 1e-52 OAY27605.1 hypothetical protein MANES_15G000100 [Manihot esculenta] 189 1e-52 >ONM31625.1 ATP-citrate synthase beta chain protein 2 [Zea mays] Length = 133 Score = 187 bits (475), Expect = 6e-57 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLV+NVDGAIGSLFLDLL+GSGMFTKQEIDEIV+IGYLNGLF Sbjct: 40 KYMEYAVQVETYTLSKANNLVMNVDGAIGSLFLDLLSGSGMFTKQEIDEIVEIGYLNGLF 99 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 100 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 133 >BAD93838.1 ATP-citrate lyase subunit B, partial [Arabidopsis thaliana] Length = 183 Score = 188 bits (477), Expect = 1e-56 Identities = 93/94 (98%), Positives = 93/94 (98%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAV VETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 90 KYMEYAVTVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 149 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 150 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 183 >NP_001168033.1 uncharacterized protein LOC100381760 [Zea mays] ACN26890.1 unknown [Zea mays] Length = 201 Score = 187 bits (475), Expect = 5e-56 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLV+NVDGAIGSLFLDLL+GSGMFTKQEIDEIV+IGYLNGLF Sbjct: 108 KYMEYAVQVETYTLSKANNLVMNVDGAIGSLFLDLLSGSGMFTKQEIDEIVEIGYLNGLF 167 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 168 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 201 >XP_016715895.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Gossypium hirsutum] Length = 328 Score = 189 bits (480), Expect = 4e-55 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLF Sbjct: 235 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLF 294 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 295 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 328 >XP_016724288.1 PREDICTED: ATP-citrate synthase beta chain protein 2-like [Gossypium hirsutum] Length = 327 Score = 187 bits (476), Expect = 1e-54 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMF+KQEIDEIV+IGYLNGLF Sbjct: 234 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFSKQEIDEIVEIGYLNGLF 293 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 294 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 327 >XP_012483153.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Gossypium raimondii] KJB38341.1 hypothetical protein B456_006G250500 [Gossypium raimondii] Length = 326 Score = 187 bits (475), Expect = 2e-54 Identities = 92/94 (97%), Positives = 93/94 (98%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLF Sbjct: 233 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLF 292 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLY HPWEDVLYTK Sbjct: 293 VLARSIGLIGHTFDQKRLKQPLYHHPWEDVLYTK 326 >XP_019576241.1 PREDICTED: ATP-citrate synthase beta chain protein 2-like, partial [Rhinolophus sinicus] Length = 385 Score = 189 bits (479), Expect = 2e-54 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVE+YTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 292 KYMEYAVQVESYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 351 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 352 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 385 >KDO71941.1 hypothetical protein CISIN_1g007327mg [Citrus sinensis] Length = 430 Score = 187 bits (476), Expect = 2e-53 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMF+KQEIDEIV+IGYLNGLF Sbjct: 337 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFSKQEIDEIVEIGYLNGLF 396 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 397 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 430 >ONM31628.1 ATP-citrate synthase beta chain protein 2 [Zea mays] Length = 430 Score = 187 bits (475), Expect = 3e-53 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLV+NVDGAIGSLFLDLL+GSGMFTKQEIDEIV+IGYLNGLF Sbjct: 337 KYMEYAVQVETYTLSKANNLVMNVDGAIGSLFLDLLSGSGMFTKQEIDEIVEIGYLNGLF 396 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 397 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 430 >XP_010464245.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Camelina sativa] Length = 608 Score = 190 bits (483), Expect = 5e-53 Identities = 94/94 (100%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >NP_187317.1 ATP-citrate lyase B-1 [Arabidopsis thaliana] NP_001326324.1 ATP-citrate lyase B-1 [Arabidopsis thaliana] Q9C522.1 RecName: Full=ATP-citrate synthase beta chain protein 1; Short=ATP-citrate synthase B-1; AltName: Full=ATP-citrate lyase B-1; AltName: Full=Citrate cleavage enzyme B-1 AAG50997.1 ATP citrate lyase, putative; 38389-41775 [Arabidopsis thaliana] AAG51326.1 ATP citrate lyase, putative; 3734-7120 [Arabidopsis thaliana] AAO22565.1 putative ATP citrate lyase [Arabidopsis thaliana] AEE74426.1 ATP-citrate lyase B-1 [Arabidopsis thaliana] OAP01706.1 ACLB-1 [Arabidopsis thaliana] ANM64284.1 ATP-citrate lyase B-1 [Arabidopsis thaliana] Length = 608 Score = 190 bits (483), Expect = 5e-53 Identities = 94/94 (100%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >XP_006407923.1 hypothetical protein EUTSA_v10020323mg [Eutrema salsugineum] ESQ49376.1 hypothetical protein EUTSA_v10020323mg [Eutrema salsugineum] Length = 608 Score = 190 bits (483), Expect = 5e-53 Identities = 94/94 (100%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >XP_006297252.1 hypothetical protein CARUB_v10013256mg [Capsella rubella] XP_010442772.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Camelina sativa] XP_010442848.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Camelina sativa] XP_010486180.1 PREDICTED: ATP-citrate synthase beta chain protein 1 isoform X1 [Camelina sativa] XP_010486181.1 PREDICTED: ATP-citrate synthase beta chain protein 1 isoform X2 [Camelina sativa] XP_019097090.1 PREDICTED: ATP-citrate synthase beta chain protein 1 isoform X3 [Camelina sativa] EOA30150.1 hypothetical protein CARUB_v10013256mg [Capsella rubella] Length = 608 Score = 190 bits (483), Expect = 5e-53 Identities = 94/94 (100%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >XP_019576302.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Rhinolophus sinicus] Length = 608 Score = 189 bits (481), Expect = 1e-52 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLV+NVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVMNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >XP_002884600.1 ATP-citrate lyase B-1 [Arabidopsis lyrata subsp. lyrata] EFH60859.1 ATP-citrate lyase B-1 [Arabidopsis lyrata subsp. lyrata] Length = 608 Score = 189 bits (481), Expect = 1e-52 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLV+NVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVMNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >XP_016454812.1 PREDICTED: ATP-citrate synthase beta chain protein 1 isoform X2 [Nicotiana tabacum] Length = 488 Score = 187 bits (474), Expect = 1e-52 Identities = 92/94 (97%), Positives = 93/94 (98%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTK EIDEIV+IGYLNGLF Sbjct: 395 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKPEIDEIVEIGYLNGLF 454 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 455 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 488 >XP_009789291.1 PREDICTED: ATP-citrate synthase beta chain protein 1 isoform X2 [Nicotiana sylvestris] Length = 488 Score = 187 bits (474), Expect = 1e-52 Identities = 92/94 (97%), Positives = 93/94 (98%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTK EIDEIV+IGYLNGLF Sbjct: 395 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKPEIDEIVEIGYLNGLF 454 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 455 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 488 >XP_018858095.1 PREDICTED: ATP-citrate synthase beta chain protein 2 [Juglans regia] XP_018858096.1 PREDICTED: ATP-citrate synthase beta chain protein 2 [Juglans regia] Length = 608 Score = 189 bits (480), Expect = 1e-52 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >OAY56132.1 hypothetical protein MANES_03G205000 [Manihot esculenta] OAY56133.1 hypothetical protein MANES_03G205000 [Manihot esculenta] Length = 608 Score = 189 bits (480), Expect = 1e-52 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >OAY27605.1 hypothetical protein MANES_15G000100 [Manihot esculenta] Length = 608 Score = 189 bits (480), Expect = 1e-52 Identities = 93/94 (98%), Positives = 94/94 (100%) Frame = -1 Query: 786 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLF 607 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLF Sbjct: 515 KYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLF 574 Query: 606 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 505 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 575 VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608