BLASTX nr result
ID: Panax24_contig00012725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00012725 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO91830.1 Ovarian tumor, otubain [Corchorus capsularis] 84 3e-16 GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterran... 84 5e-16 GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterran... 84 5e-16 XP_017983490.1 PREDICTED: OTU domain-containing protein 5 [Theob... 83 9e-16 XP_003596850.2 OTU-like cysteine protease [Medicago truncatula] ... 83 1e-15 OMO59917.1 Ovarian tumor, otubain [Corchorus olitorius] 83 1e-15 XP_015872988.1 PREDICTED: OTU domain-containing protein 5 isofor... 82 2e-15 XP_015872967.1 PREDICTED: OTU domain-containing protein 5 isofor... 82 2e-15 XP_014619606.1 PREDICTED: OTU domain-containing protein 5-like i... 82 2e-15 XP_003538105.1 PREDICTED: OTU domain-containing protein 5-like i... 82 2e-15 XP_017183879.1 PREDICTED: OTU domain-containing protein 5-like, ... 80 3e-15 XP_019413585.1 PREDICTED: OTU domain-containing protein 5-A isof... 81 4e-15 XP_019413584.1 PREDICTED: OTU domain-containing protein 5-A isof... 81 4e-15 XP_019413582.1 PREDICTED: OTU domain-containing protein 5 isofor... 81 4e-15 OIV99270.1 hypothetical protein TanjilG_17080 [Lupinus angustifo... 81 4e-15 KHN38615.1 OTU domain-containing protein 5 [Glycine soja] 81 5e-15 XP_017241992.1 PREDICTED: OTU domain-containing protein 5 [Daucu... 81 5e-15 KHN21165.1 OTU domain-containing protein 5 [Glycine soja] 81 5e-15 XP_003539838.1 PREDICTED: OTU domain-containing protein 5-like [... 81 5e-15 GAV86657.1 OTU domain-containing protein [Cephalotus follicularis] 81 6e-15 >OMO91830.1 Ovarian tumor, otubain [Corchorus capsularis] Length = 537 Score = 84.3 bits (207), Expect = 3e-16 Identities = 44/69 (63%), Positives = 50/69 (72%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRE---RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TK+E +E R+N GFSYLQAIEAYSIFG+DVDSMVCYL+ET S Sbjct: 469 GSETKLEGSKEQVLRDNVLSSSMQILLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGSS 528 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 529 SRRKGKATE 537 >GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterraneum] Length = 623 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 GS K E G+E ++ GFSYLQAIEAYSIFG+DVDSM+CYL+ET SSRR Sbjct: 558 GSDPKTEHGKENDSILSSSIHMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLETGSSSRR 617 Query: 183 KGKATE 200 KGKATE Sbjct: 618 KGKATE 623 >GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterraneum] Length = 625 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 GS K E G+E ++ GFSYLQAIEAYSIFG+DVDSM+CYL+ET SSRR Sbjct: 560 GSDPKTEHGKENDSILSSSIHMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLETGSSSRR 619 Query: 183 KGKATE 200 KGKATE Sbjct: 620 KGKATE 625 >XP_017983490.1 PREDICTED: OTU domain-containing protein 5 [Theobroma cacao] XP_017983491.1 PREDICTED: OTU domain-containing protein 5 [Theobroma cacao] XP_017983492.1 PREDICTED: OTU domain-containing protein 5 [Theobroma cacao] Length = 537 Score = 83.2 bits (204), Expect = 9e-16 Identities = 44/69 (63%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRE---RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TKVE +E R+ GFSYLQAIEAYSIFG+DVDSMVCYL+ET S Sbjct: 469 GSETKVEGSKEQGLRDTVLSSGIQILLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGSS 528 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 529 SRRKGKATE 537 >XP_003596850.2 OTU-like cysteine protease [Medicago truncatula] AES67101.2 OTU-like cysteine protease [Medicago truncatula] Length = 531 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 GS K+ESG+ + GFSYLQAIEAYSIFG+DVDSM+CYL+ET SSRR Sbjct: 466 GSDPKMESGKGNNSNLSSSMNMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLETGSSSRR 525 Query: 183 KGKATE 200 KGKATE Sbjct: 526 KGKATE 531 >OMO59917.1 Ovarian tumor, otubain [Corchorus olitorius] Length = 537 Score = 82.8 bits (203), Expect = 1e-15 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRER---ENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TK+E +E+ +N GFSYLQAIEAYSIFG+DVDSMVCYL+ET S Sbjct: 469 GSETKLEGSKEQVLQDNVLSSSMQILLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGSS 528 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 529 SRRKGKATE 537 >XP_015872988.1 PREDICTED: OTU domain-containing protein 5 isoform X2 [Ziziphus jujuba] Length = 536 Score = 82.4 bits (202), Expect = 2e-15 Identities = 44/69 (63%), Positives = 50/69 (72%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRE---RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TKVE R+ +++ GFSYLQ IEAYSIFGEDVDSMVCYL+ETS S Sbjct: 468 GSETKVEGRRDHGVQDSVLSNSMQMVLSMGFSYLQVIEAYSIFGEDVDSMVCYLLETSSS 527 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 528 SRRKGKATE 536 >XP_015872967.1 PREDICTED: OTU domain-containing protein 5 isoform X1 [Ziziphus jujuba] XP_015872974.1 PREDICTED: OTU domain-containing protein 5 isoform X1 [Ziziphus jujuba] XP_015872981.1 PREDICTED: OTU domain-containing protein 5 isoform X1 [Ziziphus jujuba] Length = 537 Score = 82.4 bits (202), Expect = 2e-15 Identities = 44/69 (63%), Positives = 50/69 (72%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRE---RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TKVE R+ +++ GFSYLQ IEAYSIFGEDVDSMVCYL+ETS S Sbjct: 469 GSETKVEGRRDHGVQDSVLSNSMQMVLSMGFSYLQVIEAYSIFGEDVDSMVCYLLETSSS 528 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 529 SRRKGKATE 537 >XP_014619606.1 PREDICTED: OTU domain-containing protein 5-like isoform X2 [Glycine max] Length = 519 Score = 82.0 bits (201), Expect = 2e-15 Identities = 41/66 (62%), Positives = 46/66 (69%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K E GRE + GFSY+QAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 454 GTDRKTEHGREHGSDLSSGMQMLLSMGFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRR 513 Query: 183 KGKATE 200 KGKATE Sbjct: 514 KGKATE 519 >XP_003538105.1 PREDICTED: OTU domain-containing protein 5-like isoform X1 [Glycine max] KRH30390.1 hypothetical protein GLYMA_11G181500 [Glycine max] Length = 520 Score = 82.0 bits (201), Expect = 2e-15 Identities = 41/66 (62%), Positives = 46/66 (69%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K E GRE + GFSY+QAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 455 GTDRKTEHGREHGSDLSSGMQMLLSMGFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRR 514 Query: 183 KGKATE 200 KGKATE Sbjct: 515 KGKATE 520 >XP_017183879.1 PREDICTED: OTU domain-containing protein 5-like, partial [Malus domestica] Length = 252 Score = 79.7 bits (195), Expect = 3e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = +3 Query: 3 GSKTKVESGRE--RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSS 176 GS+TKVE + +++ GFSYLQ IEAYSIFG+DVDSMVCYL+ETS SS Sbjct: 185 GSETKVEEREQGFQDSTLSSSMQVVLSMGFSYLQVIEAYSIFGDDVDSMVCYLLETSSSS 244 Query: 177 RRKGKATE 200 RRKGKATE Sbjct: 245 RRKGKATE 252 >XP_019413585.1 PREDICTED: OTU domain-containing protein 5-A isoform X3 [Lupinus angustifolius] Length = 522 Score = 81.3 bits (199), Expect = 4e-15 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K+E+G+E GFSYLQAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 457 GTDPKMEAGKEHGCDLSSSMQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGNSSRR 516 Query: 183 KGKATE 200 KGKATE Sbjct: 517 KGKATE 522 >XP_019413584.1 PREDICTED: OTU domain-containing protein 5-A isoform X2 [Lupinus angustifolius] Length = 523 Score = 81.3 bits (199), Expect = 4e-15 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K+E+G+E GFSYLQAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 458 GTDPKMEAGKEHGCDLSSSMQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGNSSRR 517 Query: 183 KGKATE 200 KGKATE Sbjct: 518 KGKATE 523 >XP_019413582.1 PREDICTED: OTU domain-containing protein 5 isoform X1 [Lupinus angustifolius] XP_019413583.1 PREDICTED: OTU domain-containing protein 5 isoform X1 [Lupinus angustifolius] Length = 526 Score = 81.3 bits (199), Expect = 4e-15 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K+E+G+E GFSYLQAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 461 GTDPKMEAGKEHGCDLSSSMQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGNSSRR 520 Query: 183 KGKATE 200 KGKATE Sbjct: 521 KGKATE 526 >OIV99270.1 hypothetical protein TanjilG_17080 [Lupinus angustifolius] Length = 700 Score = 81.3 bits (199), Expect = 4e-15 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K+E+G+E GFSYLQAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 635 GTDPKMEAGKEHGCDLSSSMQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETGNSSRR 694 Query: 183 KGKATE 200 KGKATE Sbjct: 695 KGKATE 700 >KHN38615.1 OTU domain-containing protein 5 [Glycine soja] Length = 453 Score = 80.9 bits (198), Expect = 5e-15 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K E G+E + GFSY+QAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 388 GTDRKTEHGKEHGSDLSSGMQMLLSMGFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRR 447 Query: 183 KGKATE 200 KGKATE Sbjct: 448 KGKATE 453 >XP_017241992.1 PREDICTED: OTU domain-containing protein 5 [Daucus carota subsp. sativus] KZN03457.1 hypothetical protein DCAR_012213 [Daucus carota subsp. sativus] Length = 505 Score = 80.9 bits (198), Expect = 5e-15 Identities = 44/69 (63%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRER---ENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GSKT E G E GFSYLQ IEAYSIFGEDVDSMVCYL+ETS S Sbjct: 437 GSKTNAEGGNEHGLPTTVLTNSMQMVLAMGFSYLQVIEAYSIFGEDVDSMVCYLLETSSS 496 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 497 SRRKGKATE 505 >KHN21165.1 OTU domain-containing protein 5 [Glycine soja] Length = 519 Score = 80.9 bits (198), Expect = 5e-15 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K E G+E + GFSY+QAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 454 GTDRKTEHGKEHGSDLSSGMQMLLSMGFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRR 513 Query: 183 KGKATE 200 KGKATE Sbjct: 514 KGKATE 519 >XP_003539838.1 PREDICTED: OTU domain-containing protein 5-like [Glycine max] KRH25268.1 hypothetical protein GLYMA_12G091600 [Glycine max] KRH25269.1 hypothetical protein GLYMA_12G091600 [Glycine max] Length = 519 Score = 80.9 bits (198), Expect = 5e-15 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = +3 Query: 3 GSKTKVESGRERENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGSSRR 182 G+ K E G+E + GFSY+QAIEAYSIFG+DVDSMVCYL+ET SSRR Sbjct: 454 GTDRKTEHGKEHGSDLSSGMQMLLSMGFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRR 513 Query: 183 KGKATE 200 KGKATE Sbjct: 514 KGKATE 519 >GAV86657.1 OTU domain-containing protein [Cephalotus follicularis] Length = 533 Score = 80.9 bits (198), Expect = 6e-15 Identities = 42/69 (60%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = +3 Query: 3 GSKTKVESGRE---RENXXXXXXXXXXXXGFSYLQAIEAYSIFGEDVDSMVCYLVETSGS 173 GS+TK+E G+E ++ GFSYLQ IEAYSIFG+DVDSMVCYL+ET S Sbjct: 465 GSETKLEHGKEGGLQDTVLSSSMRIVLSMGFSYLQVIEAYSIFGDDVDSMVCYLLETGSS 524 Query: 174 SRRKGKATE 200 SRRKGKATE Sbjct: 525 SRRKGKATE 533