BLASTX nr result
ID: Panax24_contig00012674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00012674 (682 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016485441.1 PREDICTED: probable GABA transporter 2 [Nicotiana... 75 1e-13 CDP12134.1 unnamed protein product [Coffea canephora] 77 6e-13 XP_016737156.1 PREDICTED: probable GABA transporter 2 isoform X1... 77 8e-13 XP_012439749.1 PREDICTED: probable GABA transporter 2 [Gossypium... 77 8e-13 XP_017604966.1 PREDICTED: probable GABA transporter 2 [Gossypium... 77 8e-13 KZV35195.1 putative GABA transporter 2 [Dorcoceras hygrometricum] 77 9e-13 XP_011101019.1 PREDICTED: probable GABA transporter 2 [Sesamum i... 77 9e-13 XP_012854246.1 PREDICTED: probable GABA transporter 2 isoform X2... 77 9e-13 XP_012854245.1 PREDICTED: probable GABA transporter 2 isoform X1... 77 9e-13 XP_009125200.2 PREDICTED: probable GABA transporter 2 [Brassica ... 75 2e-12 XP_016555806.1 PREDICTED: probable GABA transporter 2 isoform X2... 75 3e-12 XP_017624576.1 PREDICTED: probable GABA transporter 2 isoform X2... 75 3e-12 XP_016742808.1 PREDICTED: probable GABA transporter 2 isoform X2... 75 3e-12 XP_012470466.1 PREDICTED: probable GABA transporter 2 isoform X2... 75 3e-12 XP_013590438.1 PREDICTED: probable GABA transporter 2 [Brassica ... 75 3e-12 CDX67509.1 BnaA07g15490D [Brassica napus] 75 3e-12 CDY63133.1 BnaC06g42450D [Brassica napus] 75 3e-12 XP_019267565.1 PREDICTED: probable GABA transporter 2 [Nicotiana... 75 3e-12 XP_009787977.1 PREDICTED: probable GABA transporter 2 isoform X2... 75 3e-12 XP_009787975.1 PREDICTED: probable GABA transporter 2 isoform X1... 75 3e-12 >XP_016485441.1 PREDICTED: probable GABA transporter 2 [Nicotiana tabacum] Length = 154 Score = 75.5 bits (184), Expect = 1e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 70 MGLVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 107 >CDP12134.1 unnamed protein product [Coffea canephora] Length = 471 Score = 77.4 bits (189), Expect = 6e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +GAVTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 88 MGAVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 125 >XP_016737156.1 PREDICTED: probable GABA transporter 2 isoform X1 [Gossypium hirsutum] Length = 448 Score = 77.0 bits (188), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 65 MGCVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 102 >XP_012439749.1 PREDICTED: probable GABA transporter 2 [Gossypium raimondii] KJB52268.1 hypothetical protein B456_008G252900 [Gossypium raimondii] Length = 448 Score = 77.0 bits (188), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 65 MGCVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 102 >XP_017604966.1 PREDICTED: probable GABA transporter 2 [Gossypium arboreum] KHG11834.1 Lysine histidine transporter 1 -like protein [Gossypium arboreum] Length = 448 Score = 77.0 bits (188), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 65 MGCVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 102 >KZV35195.1 putative GABA transporter 2 [Dorcoceras hygrometricum] Length = 452 Score = 77.0 bits (188), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGVVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 106 >XP_011101019.1 PREDICTED: probable GABA transporter 2 [Sesamum indicum] Length = 452 Score = 77.0 bits (188), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGVVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 106 >XP_012854246.1 PREDICTED: probable GABA transporter 2 isoform X2 [Erythranthe guttata] EYU23379.1 hypothetical protein MIMGU_mgv1a006161mg [Erythranthe guttata] EYU23380.1 hypothetical protein MIMGU_mgv1a006161mg [Erythranthe guttata] Length = 454 Score = 77.0 bits (188), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 71 MGVVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 108 >XP_012854245.1 PREDICTED: probable GABA transporter 2 isoform X1 [Erythranthe guttata] Length = 470 Score = 77.0 bits (188), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEKAGRRHIRFRELAADVLG Sbjct: 87 MGVVTFYSYYLMSLVLDHCEKAGRRHIRFRELAADVLG 124 >XP_009125200.2 PREDICTED: probable GABA transporter 2 [Brassica rapa] Length = 381 Score = 75.5 bits (184), Expect = 2e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFYAYYLMS VLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGLVTFYAYYLMSKVLDHCEKAGRRHIRFRELAADVLG 106 >XP_016555806.1 PREDICTED: probable GABA transporter 2 isoform X2 [Capsicum annuum] Length = 425 Score = 75.5 bits (184), Expect = 3e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 42 MGLVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 79 >XP_017624576.1 PREDICTED: probable GABA transporter 2 isoform X2 [Gossypium arboreum] Length = 434 Score = 75.5 bits (184), Expect = 3e-12 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLGC*CGKMGFAEEELQ 365 LG VTFY+YYLMS VL+HCEKAGRRHIRFRELAADVLG G + A E L+ Sbjct: 69 LGCVTFYSYYLMSKVLEHCEKAGRRHIRFRELAADVLGVGIGAILLAGECLK 120 >XP_016742808.1 PREDICTED: probable GABA transporter 2 isoform X2 [Gossypium hirsutum] Length = 434 Score = 75.5 bits (184), Expect = 3e-12 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLGC*CGKMGFAEEELQ 365 LG VTFY+YYLMS VL+HCEKAGRRHIRFRELAADVLG G + A E L+ Sbjct: 69 LGCVTFYSYYLMSKVLEHCEKAGRRHIRFRELAADVLGVGIGAILLAGECLK 120 >XP_012470466.1 PREDICTED: probable GABA transporter 2 isoform X2 [Gossypium raimondii] Length = 434 Score = 75.5 bits (184), Expect = 3e-12 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLGC*CGKMGFAEEELQ 365 LG VTFY+YYLMS VL+HCEKAGRRHIRFRELAADVLG G + A E L+ Sbjct: 69 LGCVTFYSYYLMSKVLEHCEKAGRRHIRFRELAADVLGVGIGAILLAGECLK 120 >XP_013590438.1 PREDICTED: probable GABA transporter 2 [Brassica oleracea var. oleracea] Length = 452 Score = 75.5 bits (184), Expect = 3e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFYAYYLMS VLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGLVTFYAYYLMSKVLDHCEKAGRRHIRFRELAADVLG 106 >CDX67509.1 BnaA07g15490D [Brassica napus] Length = 452 Score = 75.5 bits (184), Expect = 3e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFYAYYLMS VLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGLVTFYAYYLMSKVLDHCEKAGRRHIRFRELAADVLG 106 >CDY63133.1 BnaC06g42450D [Brassica napus] Length = 452 Score = 75.5 bits (184), Expect = 3e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFYAYYLMS VLDHCEKAGRRHIRFRELAADVLG Sbjct: 69 MGLVTFYAYYLMSKVLDHCEKAGRRHIRFRELAADVLG 106 >XP_019267565.1 PREDICTED: probable GABA transporter 2 [Nicotiana attenuata] OIT34303.1 putative gaba transporter 2 [Nicotiana attenuata] Length = 453 Score = 75.5 bits (184), Expect = 3e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 70 MGLVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 107 >XP_009787977.1 PREDICTED: probable GABA transporter 2 isoform X2 [Nicotiana sylvestris] Length = 453 Score = 75.5 bits (184), Expect = 3e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 70 MGLVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 107 >XP_009787975.1 PREDICTED: probable GABA transporter 2 isoform X1 [Nicotiana sylvestris] Length = 453 Score = 75.5 bits (184), Expect = 3e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 210 LGAVTFYAYYLMSLVLDHCEKAGRRHIRFRELAADVLG 323 +G VTFY+YYLMSLVLDHCEK+GRRHIRFRELAADVLG Sbjct: 70 MGLVTFYSYYLMSLVLDHCEKSGRRHIRFRELAADVLG 107