BLASTX nr result
ID: Panax24_contig00012234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00012234 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224915.1 PREDICTED: uncharacterized protein LOC108201122 [... 54 2e-06 >XP_017224915.1 PREDICTED: uncharacterized protein LOC108201122 [Daucus carota subsp. sativus] KZM81718.1 hypothetical protein DCAR_029331 [Daucus carota subsp. sativus] Length = 113 Score = 53.5 bits (127), Expect = 2e-06 Identities = 21/56 (37%), Positives = 39/56 (69%) Frame = -3 Query: 311 GYGYFMWYDPPMQLRAIQVIPGLLRKLRTFENEVQNVRRKHRIYKIIIWVSLIFLL 144 G GY+ W+DPP++ R+ +IPGLLRK+ E E++ ++RK + K +W+ ++ ++ Sbjct: 49 GCGYYRWHDPPVEGRSKNIIPGLLRKIEMLEEEIKELKRKEQ--KDAMWLRVVIVV 102