BLASTX nr result
ID: Panax24_contig00012135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00012135 (471 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016193769.1 PREDICTED: ribosomal RNA small subunit methyltran... 58 6e-07 XP_002270274.1 PREDICTED: ribosomal RNA small subunit methyltran... 56 3e-06 XP_019159453.1 PREDICTED: ribosomal RNA small subunit methyltran... 56 3e-06 XP_017216935.1 PREDICTED: ribosomal RNA small subunit methyltran... 55 4e-06 XP_017216934.1 PREDICTED: ribosomal RNA small subunit methyltran... 55 4e-06 >XP_016193769.1 PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic [Arachis ipaensis] Length = 336 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 471 IEEALRSIDLPPTSRPEELTIEDFVRLHSMIVKE 370 IEEALRSI L PTSRPEELT++DFV+LH++IVKE Sbjct: 303 IEEALRSISLLPTSRPEELTLDDFVKLHNLIVKE 336 >XP_002270274.1 PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic [Vitis vinifera] CBI38785.3 unnamed protein product, partial [Vitis vinifera] Length = 335 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 471 IEEALRSIDLPPTSRPEELTIEDFVRLHSMIVK 373 IEEALR++ LP TSRPEELT++DFVRLH++IVK Sbjct: 302 IEEALRNVGLPATSRPEELTLDDFVRLHNLIVK 334 >XP_019159453.1 PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic [Ipomoea nil] Length = 348 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 471 IEEALRSIDLPPTSRPEELTIEDFVRLHSMIVKE 370 IEEAL S+ LPPTSRPEEL + DFVRLH++IVKE Sbjct: 315 IEEALGSLGLPPTSRPEELALADFVRLHNLIVKE 348 >XP_017216935.1 PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic isoform X2 [Daucus carota subsp. sativus] Length = 335 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 471 IEEALRSIDLPPTSRPEELTIEDFVRLHSMIVK 373 IEEAL++I+LP TSRPEELTIEDFV LH++IVK Sbjct: 292 IEEALKNINLPATSRPEELTIEDFVNLHAVIVK 324 >XP_017216934.1 PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic isoform X1 [Daucus carota subsp. sativus] KZM86760.1 hypothetical protein DCAR_023894 [Daucus carota subsp. sativus] Length = 354 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 471 IEEALRSIDLPPTSRPEELTIEDFVRLHSMIVK 373 IEEAL++I+LP TSRPEELTIEDFV LH++IVK Sbjct: 311 IEEALKNINLPATSRPEELTIEDFVNLHAVIVK 343