BLASTX nr result
ID: Panax24_contig00011837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00011837 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019453922.1 PREDICTED: cyclin-dependent kinases regulatory su... 77 3e-16 KNA09865.1 hypothetical protein SOVF_149530, partial [Spinacia o... 77 3e-16 XP_011009277.1 PREDICTED: cyclin-dependent kinases regulatory su... 77 3e-16 ABK94640.1 unknown [Populus trichocarpa] 77 3e-16 XP_010689923.1 PREDICTED: cyclin-dependent kinases regulatory su... 77 4e-16 XP_015628990.1 PREDICTED: cyclin-dependent kinases regulatory su... 77 4e-16 ERN08332.1 hypothetical protein AMTR_s00276p00017590 [Amborella ... 76 4e-16 XP_017181109.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 7e-16 EPS59959.1 hypothetical protein M569_14849, partial [Genlisea au... 76 7e-16 XP_018833026.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 8e-16 XP_015161426.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 8e-16 XP_019199486.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 8e-16 OAY38103.1 hypothetical protein MANES_11G152900 [Manihot esculenta] 76 8e-16 JAU77543.1 Cyclin-dependent kinases regulatory subunit 2 [Noccae... 76 9e-16 XP_017247035.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 9e-16 XP_010109923.1 Cyclin-dependent kinases regulatory subunit 2 [Mo... 76 9e-16 XP_006295341.1 hypothetical protein CARUB_v10024432mg [Capsella ... 76 9e-16 AAO13226.1 CKS1 protein [Populus tremula x Populus tremuloides] ... 76 9e-16 XP_011028271.1 PREDICTED: cyclin-dependent kinases regulatory su... 76 9e-16 NP_180364.1 CDK-subunit 2 [Arabidopsis thaliana] XP_002879124.1 ... 76 9e-16 >XP_019453922.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Lupinus angustifolius] OIW05835.1 hypothetical protein TanjilG_23621 [Lupinus angustifolius] Length = 75 Score = 77.4 bits (189), Expect = 3e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 73 >KNA09865.1 hypothetical protein SOVF_149530, partial [Spinacia oleracea] Length = 84 Score = 77.4 bits (189), Expect = 3e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 38 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 70 >XP_011009277.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Populus euphratica] XP_011009278.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Populus euphratica] Length = 84 Score = 77.4 bits (189), Expect = 3e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 73 >ABK94640.1 unknown [Populus trichocarpa] Length = 84 Score = 77.4 bits (189), Expect = 3e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 73 >XP_010689923.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Beta vulgaris subsp. vulgaris] KMT01762.1 hypothetical protein BVRB_9g210460 [Beta vulgaris subsp. vulgaris] Length = 87 Score = 77.4 bits (189), Expect = 4e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 73 >XP_015628990.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Oryza sativa Japonica Group] Q6PS57.1 RecName: Full=Cyclin-dependent kinases regulatory subunit 1 A2XCH8.1 RecName: Full=Cyclin-dependent kinases regulatory subunit 1 AAK98736.1 Putative cyclin-dependent kinase regulatory subunit [Oryza sativa Japonica Group] AAS99236.1 cyclin-dependent kinase subunit [Oryza sativa Japonica Group] ABF93962.1 cyclin-dependent kinases regulatory subunit, putative, expressed [Oryza sativa Japonica Group] BAF10871.1 Os03g0146300 [Oryza sativa Japonica Group] EAY88538.1 hypothetical protein OsI_10011 [Oryza sativa Indica Group] EAZ25575.1 hypothetical protein OsJ_09400 [Oryza sativa Japonica Group] BAH00466.1 unnamed protein product [Oryza sativa Japonica Group] BAS82279.1 Os03g0146300 [Oryza sativa Japonica Group] Length = 90 Score = 77.4 bits (189), Expect = 4e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 73 >ERN08332.1 hypothetical protein AMTR_s00276p00017590 [Amborella trichopoda] Length = 53 Score = 76.3 bits (186), Expect = 4e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 6 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 38 >XP_017181109.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Malus domestica] Length = 76 Score = 76.3 bits (186), Expect = 7e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 29 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 61 >EPS59959.1 hypothetical protein M569_14849, partial [Genlisea aurea] Length = 76 Score = 76.3 bits (186), Expect = 7e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 31 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 63 >XP_018833026.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1-like, partial [Juglans regia] Length = 79 Score = 76.3 bits (186), Expect = 8e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 32 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 64 >XP_015161426.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1, partial [Solanum tuberosum] Length = 79 Score = 76.3 bits (186), Expect = 8e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >XP_019199486.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Ipomoea nil] Length = 81 Score = 76.3 bits (186), Expect = 8e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >OAY38103.1 hypothetical protein MANES_11G152900 [Manihot esculenta] Length = 81 Score = 76.3 bits (186), Expect = 8e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >JAU77543.1 Cyclin-dependent kinases regulatory subunit 2 [Noccaea caerulescens] Length = 82 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >XP_017247035.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Daucus carota subsp. sativus] KZM97137.1 hypothetical protein DCAR_015501 [Daucus carota subsp. sativus] Length = 82 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >XP_010109923.1 Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] EXC24899.1 Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >XP_006295341.1 hypothetical protein CARUB_v10024432mg [Capsella rubella] EOA28239.1 hypothetical protein CARUB_v10024432mg [Capsella rubella] Length = 82 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >AAO13226.1 CKS1 protein [Populus tremula x Populus tremuloides] ABK95998.1 unknown [Populus trichocarpa] ABK96697.1 unknown [Populus trichocarpa x Populus deltoides] Length = 83 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >XP_011028271.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Populus euphratica] Length = 83 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >NP_180364.1 CDK-subunit 2 [Arabidopsis thaliana] XP_002879124.1 cdk-subunit 2 [Arabidopsis lyrata subsp. lyrata] Q9SJJ5.1 RecName: Full=Cyclin-dependent kinases regulatory subunit 2 AAD21505.1 putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] AAR24151.1 At2g27970 [Arabidopsis thaliana] AAR92293.1 At2g27970 [Arabidopsis thaliana] EFH55383.1 cdk-subunit 2 [Arabidopsis lyrata subsp. lyrata] AEC08065.1 CDK-subunit 2 [Arabidopsis thaliana] OAP11293.1 CKS2 [Arabidopsis thaliana] Length = 83 Score = 76.3 bits (186), Expect = 9e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNF 99 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLN+ Sbjct: 41 WRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73