BLASTX nr result
ID: Panax24_contig00011603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00011603 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015889703.1 PREDICTED: protein FMP32, mitochondrial-like [Ziz... 55 3e-06 >XP_015889703.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] XP_015889704.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] XP_015889705.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] XP_015889706.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] XP_015889707.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] XP_015889708.1 PREDICTED: protein FMP32, mitochondrial-like [Ziziphus jujuba] Length = 236 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/70 (47%), Positives = 41/70 (58%) Frame = -1 Query: 212 MAAYAACKRAGQLGVKSGIKLSLLRVIGVAXXXXXXXXXXXXXXXSTWNRIDTRQISQLV 33 MAA AACKR GQLG SGI++S V G + + +D RQ+SQLV Sbjct: 1 MAAAAACKRVGQLGRNSGIRVSGSGVYGAS---------QVLFPAFRYPHLDCRQVSQLV 51 Query: 32 QSNGKRVFLV 3 +SNGKR+FLV Sbjct: 52 RSNGKRLFLV 61