BLASTX nr result
ID: Panax24_contig00011020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00011020 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM83660.1 hypothetical protein DCAR_028918 [Daucus carota subsp... 96 2e-20 XP_017223493.1 PREDICTED: B3 domain-containing protein Os07g0679... 96 2e-20 XP_017223492.1 PREDICTED: B3 domain-containing protein Os07g0679... 96 2e-20 XP_017223491.1 PREDICTED: B3 domain-containing protein Os07g0679... 96 2e-20 XP_017218547.1 PREDICTED: B3 domain-containing protein Os07g0679... 93 2e-19 KZM86842.1 hypothetical protein DCAR_023976 [Daucus carota subsp... 93 2e-19 XP_017218546.1 PREDICTED: B3 domain-containing transcription rep... 93 2e-19 XP_017218545.1 PREDICTED: B3 domain-containing transcription rep... 93 2e-19 XP_019071659.1 PREDICTED: B3 domain-containing protein Os07g0679... 83 4e-16 XP_006362352.1 PREDICTED: B3 domain-containing transcription rep... 83 4e-16 XP_010327710.1 PREDICTED: B3 domain-containing transcription rep... 83 4e-16 XP_006362351.1 PREDICTED: B3 domain-containing transcription rep... 83 4e-16 XP_004249040.1 PREDICTED: B3 domain-containing transcription rep... 83 4e-16 XP_010327708.1 PREDICTED: B3 domain-containing transcription rep... 83 4e-16 XP_007033532.2 PREDICTED: B3 domain-containing transcription rep... 82 7e-16 EOY04458.1 Transcription factor, putative isoform 3 [Theobroma c... 82 7e-16 XP_007033531.2 PREDICTED: B3 domain-containing transcription rep... 82 7e-16 EOY04457.1 High-level expression of sugar-inducible gene 2, puta... 82 7e-16 EOY04456.1 High-level expression of sugar-inducible gene 2, puta... 82 7e-16 XP_015055849.1 PREDICTED: B3 domain-containing transcription rep... 82 1e-15 >KZM83660.1 hypothetical protein DCAR_028918 [Daucus carota subsp. sativus] Length = 586 Score = 95.5 bits (236), Expect = 2e-20 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = +2 Query: 8 FIGYFSHEFDMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALEL 187 F +FS + W+ TDKHGG GM GSL P +LA ERKRS+ IG SKRLLIDNQDALEL Sbjct: 412 FSKHFSPSSEDAWHFTDKHGGRGMIGSLAPTLLAPERKRSKKIGSTSKRLLIDNQDALEL 471 Query: 188 KLTWEEIQEI 217 KLTW+EIQE+ Sbjct: 472 KLTWDEIQEM 481 >XP_017223493.1 PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X3 [Daucus carota subsp. sativus] Length = 822 Score = 95.5 bits (236), Expect = 2e-20 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = +2 Query: 8 FIGYFSHEFDMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALEL 187 F +FS + W+ TDKHGG GM GSL P +LA ERKRS+ IG SKRLLIDNQDALEL Sbjct: 395 FSKHFSPSSEDAWHFTDKHGGRGMIGSLAPTLLAPERKRSKKIGSTSKRLLIDNQDALEL 454 Query: 188 KLTWEEIQEI 217 KLTW+EIQE+ Sbjct: 455 KLTWDEIQEM 464 >XP_017223492.1 PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X2 [Daucus carota subsp. sativus] Length = 824 Score = 95.5 bits (236), Expect = 2e-20 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = +2 Query: 8 FIGYFSHEFDMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALEL 187 F +FS + W+ TDKHGG GM GSL P +LA ERKRS+ IG SKRLLIDNQDALEL Sbjct: 397 FSKHFSPSSEDAWHFTDKHGGRGMIGSLAPTLLAPERKRSKKIGSTSKRLLIDNQDALEL 456 Query: 188 KLTWEEIQEI 217 KLTW+EIQE+ Sbjct: 457 KLTWDEIQEM 466 >XP_017223491.1 PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X1 [Daucus carota subsp. sativus] Length = 827 Score = 95.5 bits (236), Expect = 2e-20 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = +2 Query: 8 FIGYFSHEFDMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALEL 187 F +FS + W+ TDKHGG GM GSL P +LA ERKRS+ IG SKRLLIDNQDALEL Sbjct: 400 FSKHFSPSSEDAWHFTDKHGGRGMIGSLAPTLLAPERKRSKKIGSTSKRLLIDNQDALEL 459 Query: 188 KLTWEEIQEI 217 KLTW+EIQE+ Sbjct: 460 KLTWDEIQEM 469 >XP_017218547.1 PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X3 [Daucus carota subsp. sativus] Length = 866 Score = 92.8 bits (229), Expect = 2e-19 Identities = 44/61 (72%), Positives = 53/61 (86%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D+ W++TDK GG + SLPP +LA E+KRSRNIGLKSKRLLI+NQDALELKLTWEE+QE Sbjct: 442 DVIWHVTDKPGGKRIIDSLPPTLLAPEKKRSRNIGLKSKRLLIENQDALELKLTWEEVQE 501 Query: 215 I 217 + Sbjct: 502 M 502 >KZM86842.1 hypothetical protein DCAR_023976 [Daucus carota subsp. sativus] Length = 896 Score = 92.8 bits (229), Expect = 2e-19 Identities = 44/61 (72%), Positives = 53/61 (86%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D+ W++TDK GG + SLPP +LA E+KRSRNIGLKSKRLLI+NQDALELKLTWEE+QE Sbjct: 494 DVIWHVTDKPGGKRIIDSLPPTLLAPEKKRSRNIGLKSKRLLIENQDALELKLTWEEVQE 553 Query: 215 I 217 + Sbjct: 554 M 554 >XP_017218546.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Daucus carota subsp. sativus] Length = 918 Score = 92.8 bits (229), Expect = 2e-19 Identities = 44/61 (72%), Positives = 53/61 (86%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D+ W++TDK GG + SLPP +LA E+KRSRNIGLKSKRLLI+NQDALELKLTWEE+QE Sbjct: 494 DVIWHVTDKPGGKRIIDSLPPTLLAPEKKRSRNIGLKSKRLLIENQDALELKLTWEEVQE 553 Query: 215 I 217 + Sbjct: 554 M 554 >XP_017218545.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Daucus carota subsp. sativus] Length = 919 Score = 92.8 bits (229), Expect = 2e-19 Identities = 44/61 (72%), Positives = 53/61 (86%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D+ W++TDK GG + SLPP +LA E+KRSRNIGLKSKRLLI+NQDALELKLTWEE+QE Sbjct: 495 DVIWHVTDKPGGKRIIDSLPPTLLAPEKKRSRNIGLKSKRLLIENQDALELKLTWEEVQE 554 Query: 215 I 217 + Sbjct: 555 M 555 >XP_019071659.1 PREDICTED: B3 domain-containing protein Os07g0679700 isoform X4 [Solanum lycopersicum] Length = 744 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 323 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 382 Query: 215 I 217 + Sbjct: 383 M 383 >XP_006362352.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Solanum tuberosum] Length = 827 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 487 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 546 Query: 215 I 217 + Sbjct: 547 M 547 >XP_010327710.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X3 [Solanum lycopersicum] Length = 832 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 492 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 551 Query: 215 I 217 + Sbjct: 552 M 552 >XP_006362351.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Solanum tuberosum] Length = 908 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 487 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 546 Query: 215 I 217 + Sbjct: 547 M 547 >XP_004249040.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Solanum lycopersicum] Length = 908 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 487 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 546 Query: 215 I 217 + Sbjct: 547 M 547 >XP_010327708.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Solanum lycopersicum] Length = 913 Score = 83.2 bits (204), Expect = 4e-16 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID DALELKL+WEE+Q+ Sbjct: 492 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLSWEELQD 551 Query: 215 I 217 + Sbjct: 552 M 552 >XP_007033532.2 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Theobroma cacao] Length = 875 Score = 82.4 bits (202), Expect = 7e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D++W+ +DKH G L P MLA ERKR+RNIG KSKRLLID+QDALELKLTWEE Q+ Sbjct: 451 DISWHKSDKHEDRTREGLLLPSMLAPERKRTRNIGSKSKRLLIDSQDALELKLTWEEAQD 510 Query: 215 I 217 + Sbjct: 511 L 511 >EOY04458.1 Transcription factor, putative isoform 3 [Theobroma cacao] Length = 875 Score = 82.4 bits (202), Expect = 7e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D++W+ +DKH G L P MLA ERKR+RNIG KSKRLLID+QDALELKLTWEE Q+ Sbjct: 451 DISWHKSDKHEDRTREGLLLPSMLAPERKRTRNIGSKSKRLLIDSQDALELKLTWEEAQD 510 Query: 215 I 217 + Sbjct: 511 L 511 >XP_007033531.2 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Theobroma cacao] Length = 911 Score = 82.4 bits (202), Expect = 7e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D++W+ +DKH G L P MLA ERKR+RNIG KSKRLLID+QDALELKLTWEE Q+ Sbjct: 487 DISWHKSDKHEDRTREGLLLPSMLAPERKRTRNIGSKSKRLLIDSQDALELKLTWEEAQD 546 Query: 215 I 217 + Sbjct: 547 L 547 >EOY04457.1 High-level expression of sugar-inducible gene 2, putative isoform 2 [Theobroma cacao] Length = 911 Score = 82.4 bits (202), Expect = 7e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D++W+ +DKH G L P MLA ERKR+RNIG KSKRLLID+QDALELKLTWEE Q+ Sbjct: 487 DISWHKSDKHEDRTREGLLLPSMLAPERKRTRNIGSKSKRLLIDSQDALELKLTWEEAQD 546 Query: 215 I 217 + Sbjct: 547 L 547 >EOY04456.1 High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] Length = 918 Score = 82.4 bits (202), Expect = 7e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D++W+ +DKH G L P MLA ERKR+RNIG KSKRLLID+QDALELKLTWEE Q+ Sbjct: 487 DISWHKSDKHEDRTREGLLLPSMLAPERKRTRNIGSKSKRLLIDSQDALELKLTWEEAQD 546 Query: 215 I 217 + Sbjct: 547 L 547 >XP_015055849.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Solanum pennellii] Length = 827 Score = 81.6 bits (200), Expect = 1e-15 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = +2 Query: 35 DMNWYMTDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDNQDALELKLTWEEIQE 214 D +WY+T+K+GG G+ P M ERKRSRNIG KSKRLLID +ALELKL+WEE+Q+ Sbjct: 487 DFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHEALELKLSWEELQD 546 Query: 215 I 217 + Sbjct: 547 M 547