BLASTX nr result
ID: Panax24_contig00011019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00011019 (733 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253699.1 PREDICTED: two-component response regulator ARR12... 58 5e-06 KZM96126.1 hypothetical protein DCAR_019368 [Daucus carota subsp... 58 5e-06 >XP_017253699.1 PREDICTED: two-component response regulator ARR12-like [Daucus carota subsp. sativus] Length = 688 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 550 MRVLAIDDDPTCLKLLDGLLRKCQYHGNLS 639 MRVLA+DDDPTCLKLL+GLLRKCQYH L+ Sbjct: 21 MRVLAVDDDPTCLKLLEGLLRKCQYHVTLA 50 >KZM96126.1 hypothetical protein DCAR_019368 [Daucus carota subsp. sativus] Length = 722 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 550 MRVLAIDDDPTCLKLLDGLLRKCQYHGNLS 639 MRVLA+DDDPTCLKLL+GLLRKCQYH L+ Sbjct: 21 MRVLAVDDDPTCLKLLEGLLRKCQYHVTLA 50