BLASTX nr result
ID: Panax24_contig00010946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00010946 (564 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236687.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-07 >XP_017236687.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Daucus carota subsp. sativus] Length = 507 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = +3 Query: 348 MAFTYGVAYLTRSGLTYSS--PRHRFLAPQFYTKFRI-NSCSRVSTAVSKLNAPNSVVVN 518 M F G+ + ++ G + S P+++ L +F T+ + NSCSR+ L NSVV+N Sbjct: 1 MGFLAGIDHNSKLGFSNSFYFPQNKLLGARFSTRLKTPNSCSRLLGTFCSLKTHNSVVLN 60 Query: 519 KGKVREFGFLKSVEL 563 +GKVREFGFLKSVEL Sbjct: 61 RGKVREFGFLKSVEL 75