BLASTX nr result
ID: Panax24_contig00010430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00010430 (566 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBJ93438.1 magnesium-protoporphyrin, partial [Schefflera arboric... 64 1e-10 CBJ93429.1 magnesium-protoporphyrin, partial [Hedera helix] 55 2e-07 CBJ93430.1 magnesium-protoporphyrin, partial [Hedera hibernica] 54 2e-07 >CBJ93438.1 magnesium-protoporphyrin, partial [Schefflera arboricola] Length = 130 Score = 63.5 bits (153), Expect(2) = 1e-10 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 566 ARFFCLSVTFQYFTLV*FIHSFCSLLNFSLPVES 465 ARFFCLSVTFQYFTLV FI SFCSLL FSLPVES Sbjct: 69 ARFFCLSVTFQYFTLVSFIRSFCSLLYFSLPVES 102 Score = 29.6 bits (65), Expect(2) = 1e-10 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 432 LNKTNVFSFNLTSLEFQFLS 373 + + FSFNLTSLEFQF S Sbjct: 111 IKQNKCFSFNLTSLEFQFSS 130 >CBJ93429.1 magnesium-protoporphyrin, partial [Hedera helix] Length = 119 Score = 54.7 bits (130), Expect(2) = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 566 ARFFCLSVTFQYFTLV*FIHSFCSLLNFSLPVES 465 ARFFCLSVTFQYF+LV H+FC LL FSLPVES Sbjct: 67 ARFFCLSVTFQYFSLV--CHNFCGLLYFSLPVES 98 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 447 STTPVLNKTNVF 412 STTPVLNKTNVF Sbjct: 104 STTPVLNKTNVF 115 >CBJ93430.1 magnesium-protoporphyrin, partial [Hedera hibernica] Length = 118 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 566 ARFFCLSVTFQYFTLV*FIHSFCSLLNFSLPVE 468 ARFFCLSVTFQYF+LV HSFC LL FSLPVE Sbjct: 67 ARFFCLSVTFQYFSLV--CHSFCGLLYFSLPVE 97 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 447 STTPVLNKTNVF 412 STTPVLNKTNVF Sbjct: 104 STTPVLNKTNVF 115