BLASTX nr result
ID: Panax24_contig00010224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00010224 (844 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237450.1 PREDICTED: L-type lectin-domain containing recept... 59 3e-06 >XP_017237450.1 PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 [Daucus carota subsp. sativus] KZN00524.1 hypothetical protein DCAR_009278 [Daucus carota subsp. sativus] Length = 704 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = -3 Query: 116 LVSTQVGDLEFIEVNLKSNNLVSSWIDYSGSTQVFNIS 3 ++STQVGDLE I+V+LKS +V+SW++YSGSTQVF+IS Sbjct: 164 MISTQVGDLESIDVDLKSGTVVNSWVEYSGSTQVFDIS 201