BLASTX nr result
ID: Panax24_contig00010101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00010101 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84118.1 hypothetical protein DCAR_028335 [Daucus carota subsp... 60 2e-08 XP_017220354.1 PREDICTED: uncharacterized protein LOC108197287 [... 60 4e-08 KZV43530.1 hypothetical protein F511_27354 [Dorcoceras hygrometr... 55 9e-07 CDP03084.1 unnamed protein product [Coffea canephora] 55 3e-06 XP_012851294.1 PREDICTED: uncharacterized protein LOC105970995 [... 54 8e-06 XP_011093831.1 PREDICTED: uncharacterized protein LOC105173681 [... 54 9e-06 >KZM84118.1 hypothetical protein DCAR_028335 [Daucus carota subsp. sativus] Length = 203 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 379 RAAKLERALEIERKSNLELQKKISTLKSKTKHEFVEPT 266 RAAKLERALE+ER SN+ELQKKI K KTK EFVEPT Sbjct: 166 RAAKLERALEVERMSNMELQKKILRTKKKTKDEFVEPT 203 >XP_017220354.1 PREDICTED: uncharacterized protein LOC108197287 [Daucus carota subsp. sativus] Length = 355 Score = 60.1 bits (144), Expect = 4e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 379 RAAKLERALEIERKSNLELQKKISTLKSKTKHEFVEPT 266 RAAKLERALE+ER SN+ELQKKI K KTK EFVEPT Sbjct: 318 RAAKLERALEVERMSNMELQKKILRTKKKTKDEFVEPT 355 >KZV43530.1 hypothetical protein F511_27354 [Dorcoceras hygrometricum] Length = 208 Score = 55.5 bits (132), Expect = 9e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 379 RAAKLERALEIERKSNLELQKKISTLKSKTKHEFVEPT 266 RAAKLERALE+ER SNLELQKKI+TLKS+ E VEPT Sbjct: 167 RAAKLERALEVERMSNLELQKKIATLKSQATQE-VEPT 203 >CDP03084.1 unnamed protein product [Coffea canephora] Length = 354 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 379 RAAKLERALEIERKSNLELQKKISTLKSKTKHEFVEPT 266 RAAKLERALE+ER SNLELQKK++T+KS+T E P+ Sbjct: 317 RAAKLERALEVERLSNLELQKKLATMKSQTSRELTGPS 354 >XP_012851294.1 PREDICTED: uncharacterized protein LOC105970995 [Erythranthe guttata] EYU25850.1 hypothetical protein MIMGU_mgv1a008890mg [Erythranthe guttata] Length = 359 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 379 RAAKLERALEIERKSNLELQKKISTLKSKTKHEFVEP 269 RAAKLERALE ER +NLELQK+++TLKS+T E +EP Sbjct: 317 RAAKLERALESERLTNLELQKRVTTLKSRTTQEPIEP 353 >XP_011093831.1 PREDICTED: uncharacterized protein LOC105173681 [Sesamum indicum] Length = 366 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 376 AAKLERALEIERKSNLELQKKISTLKSKTKHEFVEPT*Q 260 AAKLERALE ER SNLELQKKI+ LKS+T E V+PT Q Sbjct: 325 AAKLERALEAERISNLELQKKITILKSQTTQEQVDPTLQ 363