BLASTX nr result
ID: Panax24_contig00010083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00010083 (440 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIZ00598.1 geranylgeranyl pyrophosphate synthase [Panax notogins... 105 2e-24 XP_016542878.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 98 1e-21 APY22350.1 geranylgeranyl diphosphate synthase, partial [Hedera ... 95 7e-21 NP_001312125.1 heterodimeric geranylgeranyl pyrophosphate syntha... 94 2e-20 XP_017257890.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 94 6e-20 XP_011046617.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 93 8e-20 XP_004246572.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 92 1e-19 XP_019250805.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 91 4e-19 AET07432.1 geranylgeranyl pyrophosphate synthase, partial [Ipomo... 85 7e-19 KZV35923.1 geranylgeranyl pyrophosphate synthase family protein ... 91 7e-19 AMK51093.1 chloroplast geranylgeranyl pyrophosphate synthase 1 [... 90 9e-19 XP_006341179.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 90 1e-18 XP_011045566.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 90 1e-18 XP_002529802.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 90 1e-18 XP_002306207.2 hypothetical protein POPTR_0004s18610g [Populus t... 90 1e-18 XP_016445326.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 90 1e-18 XP_009589555.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 90 1e-18 XP_011092951.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 89 2e-18 XP_018853159.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 89 2e-18 XP_012833776.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 89 2e-18 >AIZ00598.1 geranylgeranyl pyrophosphate synthase [Panax notoginseng] Length = 343 Score = 105 bits (262), Expect = 2e-24 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYG++VLPLY+FVDYA DRGFS+G+Q+ Sbjct: 288 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGERVLPLYSFVDYAVDRGFSVGDQV 343 >XP_016542878.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] XP_016542879.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] XP_016542880.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] XP_016542881.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] XP_016542882.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Capsicum annuum] Length = 336 Score = 98.2 bits (243), Expect = 1e-21 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVSVYGVEKAMEVAEDLR +AKRELD F+KYGDKV+PLY+FVDYAADRGF++ Q+ Sbjct: 281 YVSVYGVEKAMEVAEDLRTQAKRELDGFEKYGDKVMPLYSFVDYAADRGFTIDTQV 336 >APY22350.1 geranylgeranyl diphosphate synthase, partial [Hedera helix] Length = 290 Score = 95.1 bits (235), Expect = 7e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVSVYGVEKAMEVAEDLRKRAK L SFDKYG++VLPLY+FVDYA DRGFS+G+ + Sbjct: 235 YVSVYGVEKAMEVAEDLRKRAKTGLVSFDKYGERVLPLYSFVDYAVDRGFSVGDHV 290 >NP_001312125.1 heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] XP_009788757.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] XP_009788758.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] XP_009788759.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana sylvestris] XP_016450347.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] XP_016450348.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] AIC77784.1 geranylgeranyl pyrophosphate synthase 5 [Nicotiana tabacum] AIC77785.1 geranylgeranyl pyrophosphate synthase 5 [Nicotiana tabacum] Length = 332 Score = 94.4 bits (233), Expect = 2e-20 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGN 278 YVS+YG+EKAMEVAEDLR +AKRELD KYGDKV+PLY+FVDYAADRGFSL N Sbjct: 279 YVSLYGIEKAMEVAEDLRAQAKRELDGLKKYGDKVIPLYSFVDYAADRGFSLDN 332 >XP_017257890.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Daucus carota subsp. sativus] KZM89807.1 geranylgeranyl pyrophosphate synthase [Daucus carota subsp. sativus] Length = 344 Score = 93.6 bits (231), Expect = 6e-20 Identities = 43/55 (78%), Positives = 51/55 (92%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQ 275 YV VYGVEKAMEVAE+LR RAKRELDSF+KYG+++LPLY+FVDYAADR F++G Q Sbjct: 289 YVRVYGVEKAMEVAEELRGRAKRELDSFEKYGERLLPLYSFVDYAADRSFTIGGQ 343 >XP_011046617.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Populus euphratica] Length = 347 Score = 93.2 bits (230), Expect = 8e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YV+VYGVEKA EVAE+LR +AK+ELD F+KYGD V+PLY+FVDYAADRGFSLG I Sbjct: 292 YVAVYGVEKAAEVAEELRAKAKKELDGFEKYGDSVVPLYSFVDYAADRGFSLGESI 347 >XP_004246572.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] XP_010325942.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] XP_010325943.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Solanum lycopersicum] Length = 334 Score = 92.4 bits (228), Expect = 1e-19 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVSVYG+EKA++VAEDLR +AKRELD +KYGDKV+PLY+F+DYAADRGFS+ Q+ Sbjct: 279 YVSVYGIEKAVKVAEDLRAQAKRELDGLEKYGDKVMPLYSFLDYAADRGFSIDGQV 334 >XP_019250805.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] XP_019250806.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] XP_019250807.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] XP_019250808.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] OIT01464.1 heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Nicotiana attenuata] Length = 332 Score = 91.3 bits (225), Expect = 4e-19 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGN 278 YVS+YG+EKA +VAEDLR +AKRELD +KYGDKV+PLY+FVDYAADRGFSL N Sbjct: 279 YVSLYGIEKAKKVAEDLRAQAKRELDGLEKYGDKVIPLYSFVDYAADRGFSLHN 332 >AET07432.1 geranylgeranyl pyrophosphate synthase, partial [Ipomoea batatas] Length = 83 Score = 84.7 bits (208), Expect = 7e-19 Identities = 39/52 (75%), Positives = 49/52 (94%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSL 284 YVSVYGVEKAMEVAE+LR +AK+ELD+ +KYGDKV+PL++FVDYAA RGF++ Sbjct: 29 YVSVYGVEKAMEVAEELRGQAKKELDALEKYGDKVIPLHSFVDYAAYRGFNV 80 >KZV35923.1 geranylgeranyl pyrophosphate synthase family protein [Dorcoceras hygrometricum] Length = 331 Score = 90.5 bits (223), Expect = 7e-19 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVS YGVEKAMEVAEDL+ +AKR LD +KYG++V+PLY+FVDYAADRGFS+G + Sbjct: 276 YVSAYGVEKAMEVAEDLKSQAKRALDGLEKYGERVMPLYSFVDYAADRGFSIGESV 331 >AMK51093.1 chloroplast geranylgeranyl pyrophosphate synthase 1 [Rehmannia glutinosa] Length = 328 Score = 90.1 bits (222), Expect = 9e-19 Identities = 41/51 (80%), Positives = 49/51 (96%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFS 287 YVS+YGV+KAMEVAEDLR +AK+ELD+ +KYG+KVLPLY+FVDYAADRGFS Sbjct: 273 YVSLYGVDKAMEVAEDLRSQAKKELDALEKYGEKVLPLYSFVDYAADRGFS 323 >XP_006341179.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] XP_006341180.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] XP_006341181.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum tuberosum] Length = 334 Score = 90.1 bits (222), Expect = 1e-18 Identities = 40/56 (71%), Positives = 51/56 (91%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YVSVYG+EKA++VAEDL +AKRELD +KYGDKV+PLY+F+DYAADRGFS+ +Q+ Sbjct: 279 YVSVYGIEKAVKVAEDLGAQAKRELDGLEKYGDKVMPLYSFLDYAADRGFSIDDQV 334 >XP_011045566.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Populus euphratica] Length = 345 Score = 90.1 bits (222), Expect = 1e-18 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLG 281 YV+ YGVEKA+EVAE+LR +AK+ELD F+KYGD VLPLY+FVDYAADRGFS G Sbjct: 290 YVAFYGVEKAIEVAEELRAKAKKELDGFEKYGDSVLPLYSFVDYAADRGFSFG 342 >XP_002529802.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Ricinus communis] EEF32584.1 geranyl geranyl pyrophosphate synthase, putative [Ricinus communis] Length = 345 Score = 90.1 bits (222), Expect = 1e-18 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLG 281 YVS+YG+EKAMEVAE+LR +AK+ELD F KYGD V+PLY+FVDYAADRGF++G Sbjct: 290 YVSLYGIEKAMEVAEELRTQAKKELDGFAKYGDSVMPLYSFVDYAADRGFTIG 342 >XP_002306207.2 hypothetical protein POPTR_0004s18610g [Populus trichocarpa] EEE86718.2 hypothetical protein POPTR_0004s18610g [Populus trichocarpa] Length = 347 Score = 90.1 bits (222), Expect = 1e-18 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGNQI 272 YV+VYGVEKA EVAE+LR +AK+ELD F+KYG+ V+PLY+FVDYAADRGFS G I Sbjct: 292 YVAVYGVEKATEVAEELRAKAKKELDGFEKYGESVVPLYSFVDYAADRGFSFGESI 347 >XP_016445326.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] XP_016445327.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tabacum] Length = 332 Score = 89.7 bits (221), Expect = 1e-18 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGN 278 YVS+YG+EKA ++AEDLR +AKRELD KYGDKV+PLY+FVDYAADRGFSL N Sbjct: 279 YVSLYGIEKAKKIAEDLRAQAKRELDGLAKYGDKVIPLYSFVDYAADRGFSLDN 332 >XP_009589555.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tomentosiformis] XP_009589556.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana tomentosiformis] Length = 332 Score = 89.7 bits (221), Expect = 1e-18 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGN 278 YVS+YG+EKA ++AEDLR +AKRELD KYGDKV+PLY+FVDYAADRGFSL N Sbjct: 279 YVSLYGIEKAKKIAEDLRAQAKRELDGLAKYGDKVIPLYSFVDYAADRGFSLDN 332 >XP_011092951.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Sesamum indicum] Length = 332 Score = 89.4 bits (220), Expect = 2e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFS 287 YVSVYGVEKA+EVAEDLR +AK+ELD ++YG+KVLPLY+FVDYAADRGFS Sbjct: 277 YVSVYGVEKAIEVAEDLRSQAKKELDGLERYGEKVLPLYSFVDYAADRGFS 327 >XP_018853159.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Juglans regia] Length = 334 Score = 89.4 bits (220), Expect = 2e-18 Identities = 40/54 (74%), Positives = 50/54 (92%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFSLGN 278 YV VYGV+KAMEVAE+LR +AKREL+ F+KYG+ V+PLY+FVDYAADRGFS+G+ Sbjct: 279 YVGVYGVDKAMEVAEELRAKAKRELNGFEKYGESVVPLYSFVDYAADRGFSVGD 332 >XP_012833776.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Erythranthe guttata] EYU40459.1 hypothetical protein MIMGU_mgv1a009868mg [Erythranthe guttata] Length = 329 Score = 89.0 bits (219), Expect = 2e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -2 Query: 439 YVSVYGVEKAMEVAEDLRKRAKRELDSFDKYGDKVLPLYNFVDYAADRGFS 287 YVS+YGVEKAMEVAE+LR AK+ELD +KYG+KVLPLY+FVDYAADRGFS Sbjct: 277 YVSIYGVEKAMEVAEELRAEAKKELDCLEKYGEKVLPLYSFVDYAADRGFS 327