BLASTX nr result
ID: Panax24_contig00009940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009940 (1043 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249097.1 PREDICTED: probable anion transporter 3, chloropl... 98 6e-19 XP_015086460.1 PREDICTED: probable anion transporter 3, chloropl... 94 2e-17 XP_004246342.1 PREDICTED: probable anion transporter 3, chloropl... 94 2e-17 XP_016542296.1 PREDICTED: probable anion transporter 3, chloropl... 94 2e-17 XP_006363062.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_019266480.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_016456858.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_016444246.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_009803867.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_009602210.1 PREDICTED: probable anion transporter 3, chloropl... 92 7e-17 XP_002527859.1 PREDICTED: probable anion transporter 3, chloropl... 91 1e-16 KVH94802.1 Major facilitator superfamily [Cynara cardunculus var... 91 1e-16 XP_018833349.1 PREDICTED: probable anion transporter 3, chloropl... 91 2e-16 XP_018833347.1 PREDICTED: probable anion transporter 3, chloropl... 91 2e-16 CDP06516.1 unnamed protein product [Coffea canephora] 89 4e-16 OMO85145.1 Major facilitator superfamily [Corchorus capsularis] 90 4e-16 XP_002323555.2 hypothetical protein POPTR_0016s11850g [Populus t... 87 9e-16 XP_010101818.1 putative anion transporter 3 [Morus notabilis] EX... 88 1e-15 XP_016671085.1 PREDICTED: probable anion transporter 3, chloropl... 87 2e-15 XP_012486197.1 PREDICTED: probable anion transporter 3, chloropl... 87 2e-15 >XP_017249097.1 PREDICTED: probable anion transporter 3, chloroplastic [Daucus carota subsp. sativus] KZM95488.1 hypothetical protein DCAR_018730 [Daucus carota subsp. sativus] Length = 514 Score = 98.2 bits (243), Expect = 6e-19 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGYI GAMSD LIKSGKS+TFTRK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAISGYIAGAMSDSLIKSGKSITFTRKVMQ 401 >XP_015086460.1 PREDICTED: probable anion transporter 3, chloroplastic [Solanum pennellii] Length = 511 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 347 FKTVFNVNLKQAAWFSAVPWGTMAISGYVAGAASDFLIKAGYSLTFVRKVMQ 398 >XP_004246342.1 PREDICTED: probable anion transporter 3, chloroplastic [Solanum lycopersicum] Length = 511 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 347 FKTVFNVNLKQAAWFSAVPWGTMAISGYVAGAASDFLIKAGYSLTFVRKVMQ 398 >XP_016542296.1 PREDICTED: probable anion transporter 3, chloroplastic [Capsicum annuum] Length = 512 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 348 FKTVFNVNLKQAAWFSAVPWGTMAISGYVAGAASDFLIKAGYSLTFVRKVMQ 399 >XP_006363062.1 PREDICTED: probable anion transporter 3, chloroplastic [Solanum tuberosum] Length = 510 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGY GA SDFLIK+G SLTF RK+MQ Sbjct: 346 FKTVFNVNLKQAAWFSAVPWGTMAISGYAAGAASDFLIKAGYSLTFVRKVMQ 397 >XP_019266480.1 PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana attenuata] OIT35020.1 putative anion transporter 3, chloroplastic [Nicotiana attenuata] Length = 514 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQ 401 >XP_016456858.1 PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana tabacum] Length = 514 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQ 401 >XP_016444246.1 PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana tabacum] Length = 514 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQ 401 >XP_009803867.1 PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana sylvestris] Length = 514 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQ 401 >XP_009602210.1 PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana tomentosiformis] Length = 514 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SDFLIK+G SLTF RK+MQ Sbjct: 350 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQ 401 >XP_002527859.1 PREDICTED: probable anion transporter 3, chloroplastic [Ricinus communis] EEF34490.1 Sialin, putative [Ricinus communis] Length = 501 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA+SGYI GA SDFLIK+G SLT RK+MQ Sbjct: 337 FKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGAASDFLIKAGYSLTLVRKVMQ 388 >KVH94802.1 Major facilitator superfamily [Cynara cardunculus var. scolymus] Length = 451 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA SGY+ GA SD+LIK G SLTF RK+MQ Sbjct: 287 FKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDYLIKEGHSLTFVRKVMQ 338 >XP_018833349.1 PREDICTED: probable anion transporter 3, chloroplastic isoform X2 [Juglans regia] Length = 512 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGYI GA SD+LIK+G SLT RKIMQ Sbjct: 348 FKTVFNVNLKQAAWFSAVPWGTMAISGYIAGATSDYLIKAGFSLTLVRKIMQ 399 >XP_018833347.1 PREDICTED: probable anion transporter 3, chloroplastic isoform X1 [Juglans regia] XP_018833348.1 PREDICTED: probable anion transporter 3, chloroplastic isoform X1 [Juglans regia] Length = 512 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGYI GA SD+LIK+G SLT RKIMQ Sbjct: 348 FKTVFNVNLKQAAWFSAVPWGTMAISGYIAGATSDYLIKAGFSLTLVRKIMQ 399 >CDP06516.1 unnamed protein product [Coffea canephora] Length = 417 Score = 89.4 bits (220), Expect = 4e-16 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VF VNLKQAAWFSAVPWGTMAISGYI GA+SD+LIK+G SLT RKIMQ Sbjct: 253 FKTVFGVNLKQAAWFSAVPWGTMAISGYIAGAISDYLIKAGYSLTLVRKIMQ 304 >OMO85145.1 Major facilitator superfamily [Corchorus capsularis] Length = 524 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMAISGY+ GA+SD LIKSG S+T RKIMQ Sbjct: 355 FKTVFNVNLKQAAWFSAVPWGTMAISGYVAGAVSDSLIKSGYSITLVRKIMQ 406 >XP_002323555.2 hypothetical protein POPTR_0016s11850g [Populus trichocarpa] EEF05316.2 hypothetical protein POPTR_0016s11850g [Populus trichocarpa] Length = 343 Score = 87.4 bits (215), Expect = 9e-16 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 F VFNVNLKQAAWFSAVPWGTMA+SGY+ GA+SD LIK+G SLT RKIMQ Sbjct: 179 FNTVFNVNLKQAAWFSAVPWGTMAVSGYVAGALSDSLIKAGYSLTIVRKIMQ 230 >XP_010101818.1 putative anion transporter 3 [Morus notabilis] EXB89955.1 putative anion transporter 3 [Morus notabilis] Length = 519 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA+SGYI GA SD+LI G SLT RKIMQ Sbjct: 353 FKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGATSDYLISKGYSLTLVRKIMQ 404 >XP_016671085.1 PREDICTED: probable anion transporter 3, chloroplastic isoform X2 [Gossypium hirsutum] Length = 506 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA+SGYI GA+SD L+K+G S+T RKIMQ Sbjct: 342 FKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGAISDSLVKAGYSITSVRKIMQ 393 >XP_012486197.1 PREDICTED: probable anion transporter 3, chloroplastic isoform X2 [Gossypium raimondii] KJB36883.1 hypothetical protein B456_006G180500 [Gossypium raimondii] Length = 506 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -2 Query: 478 FK*VFNVNLKQAAWFSAVPWGTMAISGYIVGAMSDFLIKSGKSLTFTRKIMQ 323 FK VFNVNLKQAAWFSAVPWGTMA+SGYI GA+SD L+K+G S+T RKIMQ Sbjct: 342 FKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGAISDSLVKAGYSITSVRKIMQ 393