BLASTX nr result
ID: Panax24_contig00009474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009474 (650 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009774473.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicoti... 99 2e-20 XP_019257119.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicoti... 99 3e-20 XP_004253129.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanu... 98 4e-20 XP_016466127.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicoti... 98 4e-20 XP_009613176.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicoti... 98 4e-20 XP_019173698.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Ipomoe... 98 5e-20 XP_015059634.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanu... 97 7e-20 XP_015059189.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanu... 97 7e-20 AHM88424.1 4CL6 [Fraxinus mandshurica] 97 7e-20 XP_016550360.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Capsic... 97 9e-20 XP_012829565.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Erythr... 97 9e-20 XP_017243044.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Daucus... 96 2e-19 XP_006342547.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanu... 96 2e-19 XP_004292919.2 PREDICTED: 4-coumarate--CoA ligase-like 5 [Fragar... 96 3e-19 XP_008221158.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Prunus... 96 3e-19 XP_007222465.1 hypothetical protein PRUPE_ppa003506mg [Prunus pe... 96 3e-19 XP_018838341.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Juglan... 94 1e-18 XP_016741834.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Gossyp... 94 1e-18 XP_016694142.1 PREDICTED: 4-coumarate--CoA ligase-like 5 isoform... 94 1e-18 XP_012478156.1 PREDICTED: 4-coumarate--CoA ligase-like 5 isoform... 94 1e-18 >XP_009774473.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana sylvestris] XP_016492700.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana tabacum] Length = 556 Score = 99.0 bits (245), Expect = 2e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRKSGS +SESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 495 PMAYVVRKSGSSLSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 547 >XP_019257119.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana attenuata] OIS96064.1 4-coumarate--coa ligase-like 5 [Nicotiana attenuata] Length = 556 Score = 98.6 bits (244), Expect = 3e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRKSGS +SESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 495 PMAYVVRKSGSTLSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 547 >XP_004253129.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum lycopersicum] Length = 552 Score = 98.2 bits (243), Expect = 4e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS ISESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 491 PMAYVVRKTGSTISESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 543 >XP_016466127.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana tabacum] Length = 556 Score = 98.2 bits (243), Expect = 4e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRKSGS +SESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 495 PMAYVVRKSGSTMSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 547 >XP_009613176.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana tomentosiformis] Length = 556 Score = 98.2 bits (243), Expect = 4e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRKSGS +SESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 495 PMAYVVRKSGSTMSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 547 >XP_019173698.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Ipomoea nil] Length = 552 Score = 97.8 bits (242), Expect = 5e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PM YVVRK+GS ISE+AVMDF+GKQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 491 PMVYVVRKTGSSISENAVMDFVGKQVAPYKRIRRVAFVASIPKNPSGKILRKD 543 >XP_015059634.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum pennellii] Length = 551 Score = 97.4 bits (241), Expect = 7e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS ISESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 490 PMAYVVRKTGSTISESAVMDFITKQVAPYKRIRRVAFVASIPKNPSGKILRKD 542 >XP_015059189.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum pennellii] Length = 551 Score = 97.4 bits (241), Expect = 7e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS +SESAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 490 PMAYVVRKTGSTLSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 542 >AHM88424.1 4CL6 [Fraxinus mandshurica] Length = 552 Score = 97.4 bits (241), Expect = 7e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS ISESAVMDFI KQVAPYK+IRRVAF ASVPKNPSGKILRKD Sbjct: 491 PMAYVVRKTGSSISESAVMDFIAKQVAPYKRIRRVAFTASVPKNPSGKILRKD 543 >XP_016550360.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Capsicum annuum] Length = 548 Score = 97.1 bits (240), Expect = 9e-20 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAY+VRKSGS ISESA+MDF+ KQVAPYK+IRRV+FVAS+PKNPSGKILRKD Sbjct: 487 PMAYIVRKSGSTISESAIMDFVAKQVAPYKRIRRVSFVASIPKNPSGKILRKD 539 >XP_012829565.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Erythranthe guttata] EYU17530.1 hypothetical protein MIMGU_mgv1a003887mg [Erythranthe guttata] Length = 557 Score = 97.1 bits (240), Expect = 9e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS ISES VMDFI KQVAPYK+IRRVAFVASVPKNPSGKILRKD Sbjct: 496 PMAYVVRKAGSAISESGVMDFIAKQVAPYKRIRRVAFVASVPKNPSGKILRKD 548 >XP_017243044.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Daucus carota subsp. sativus] KZN00769.1 hypothetical protein DCAR_009523 [Daucus carota subsp. sativus] Length = 541 Score = 95.9 bits (237), Expect = 2e-19 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS+IS SAVM+F+ KQVAPYKKIRRVAFVASVPKNPSGKILRKD Sbjct: 480 PMAYVVRKTGSDISGSAVMNFVAKQVAPYKKIRRVAFVASVPKNPSGKILRKD 532 >XP_006342547.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum tuberosum] Length = 551 Score = 95.9 bits (237), Expect = 2e-19 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS IS SAVMDFI KQVAPYK+IRRVAFVAS+PKNPSGKILRKD Sbjct: 490 PMAYVVRKTGSTISASAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKD 542 >XP_004292919.2 PREDICTED: 4-coumarate--CoA ligase-like 5 [Fragaria vesca subsp. vesca] Length = 561 Score = 95.5 bits (236), Expect = 3e-19 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS +SE+AVMDFI KQVAPYK+IR+VAF+ASVPKNPSGKILRKD Sbjct: 497 PMAYVVRKAGSNLSETAVMDFIAKQVAPYKRIRKVAFIASVPKNPSGKILRKD 549 >XP_008221158.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Prunus mume] Length = 568 Score = 95.5 bits (236), Expect = 3e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS +SE VM+F+GKQVAPYKKIRRVAF+ASVPKNPSGKILRKD Sbjct: 502 PMAYVVRKAGSNLSEKDVMEFVGKQVAPYKKIRRVAFIASVPKNPSGKILRKD 554 >XP_007222465.1 hypothetical protein PRUPE_ppa003506mg [Prunus persica] ONI32244.1 hypothetical protein PRUPE_1G355900 [Prunus persica] Length = 569 Score = 95.5 bits (236), Expect = 3e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS +SE VM+F+GKQVAPYKKIRRVAF+ASVPKNPSGKILRKD Sbjct: 504 PMAYVVRKAGSNLSEKDVMEFVGKQVAPYKKIRRVAFIASVPKNPSGKILRKD 556 >XP_018838341.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Juglans regia] Length = 549 Score = 94.0 bits (232), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK+GS +SESA+MDF+ QVAPYK+IRRVAF+AS+PKNPSGKILRKD Sbjct: 488 PMAYVVRKAGSNLSESAIMDFVAGQVAPYKRIRRVAFIASIPKNPSGKILRKD 540 >XP_016741834.1 PREDICTED: 4-coumarate--CoA ligase-like 5 [Gossypium hirsutum] Length = 549 Score = 94.0 bits (232), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK GS +SE+ VMDF+G+QVAPYK+IR+VAFVAS+PKNPSGKILRKD Sbjct: 488 PMAYVVRKPGSNLSETGVMDFVGRQVAPYKRIRKVAFVASIPKNPSGKILRKD 540 >XP_016694142.1 PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Gossypium hirsutum] Length = 549 Score = 94.0 bits (232), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK GS +SE+ VMDF+G+QVAPYK+IR+VAFVAS+PKNPSGKILRKD Sbjct: 488 PMAYVVRKPGSNLSETGVMDFVGRQVAPYKRIRKVAFVASIPKNPSGKILRKD 540 >XP_012478156.1 PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Gossypium raimondii] KJB29668.1 hypothetical protein B456_005G113000 [Gossypium raimondii] Length = 549 Score = 94.0 bits (232), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 650 PMAYVVRKSGSEISESAVMDFIGKQVAPYKKIRRVAFVASVPKNPSGKILRKD 492 PMAYVVRK GS +SE+ VMDF+G+QVAPYK+IR+VAFVAS+PKNPSGKILRKD Sbjct: 488 PMAYVVRKPGSNLSETGVMDFVGRQVAPYKRIRKVAFVASIPKNPSGKILRKD 540