BLASTX nr result
ID: Panax24_contig00009436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009436 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004505441.1 PREDICTED: trafficking protein particle complex s... 160 2e-47 XP_009790671.1 PREDICTED: trafficking protein particle complex s... 159 4e-47 XP_016545163.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 XP_016490550.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 KVI10355.1 NO signaling/Golgi transport ligand-binding domain-co... 159 6e-47 XP_015055599.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 XP_009611795.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 XP_009607184.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 XP_006352489.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 XP_007028550.1 PREDICTED: trafficking protein particle complex s... 159 6e-47 CDP05796.1 unnamed protein product [Coffea canephora] 159 8e-47 XP_002522846.1 PREDICTED: trafficking protein particle complex s... 159 8e-47 XP_010272867.1 PREDICTED: trafficking protein particle complex s... 158 1e-46 XP_012089644.1 PREDICTED: trafficking protein particle complex s... 158 1e-46 XP_012070743.1 PREDICTED: trafficking protein particle complex s... 158 1e-46 XP_006347669.1 PREDICTED: trafficking protein particle complex s... 158 1e-46 XP_012827478.1 PREDICTED: trafficking protein particle complex s... 158 1e-46 XP_010105578.1 hypothetical protein L484_011896 [Morus notabilis... 156 1e-46 XP_020109386.1 trafficking protein particle complex subunit 3 [A... 158 2e-46 XP_019196898.1 PREDICTED: trafficking protein particle complex s... 158 2e-46 >XP_004505441.1 PREDICTED: trafficking protein particle complex subunit 3 [Cicer arietinum] Length = 186 Score = 160 bits (405), Expect = 2e-47 Identities = 81/85 (95%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA++ERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANIERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDFRETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFRETAEVIAK 85 >XP_009790671.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana sylvestris] XP_016482489.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tabacum] Length = 186 Score = 159 bits (403), Expect = 4e-47 Identities = 81/85 (95%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85 >XP_016545163.1 PREDICTED: trafficking protein particle complex subunit 3-like isoform X2 [Capsicum annuum] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS C+DF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCIDFKETAEVIAK 85 >XP_016490550.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tabacum] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS C+DF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCIDFKETAEVIAK 85 >KVI10355.1 NO signaling/Golgi transport ligand-binding domain-containing protein [Cynara cardunculus var. scolymus] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPV PRSGDAIFA+VERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVVPRSGDAIFANVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNV+ CVDFRETAEVIAK Sbjct: 61 IDEFLAKSNVTRCVDFRETAEVIAK 85 >XP_015055599.1 PREDICTED: trafficking protein particle complex subunit 3-like [Solanum pennellii] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS C+DF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCIDFKETAEVIAK 85 >XP_009611795.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tomentosiformis] XP_009792848.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana sylvestris] XP_016512329.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tabacum] XP_019251764.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana attenuata] OIS99094.1 hypothetical protein A4A49_62618 [Nicotiana attenuata] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS C+DF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCIDFKETAEVIAK 85 >XP_009607184.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tomentosiformis] XP_016482540.1 PREDICTED: trafficking protein particle complex subunit 3-like [Nicotiana tabacum] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAE+IAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEIIAK 85 >XP_006352489.1 PREDICTED: trafficking protein particle complex subunit 3-like [Solanum tuberosum] XP_010327161.1 PREDICTED: trafficking protein particle complex subunit 3 [Solanum lycopersicum] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS C+DF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCIDFKETAEVIAK 85 >XP_007028550.1 PREDICTED: trafficking protein particle complex subunit 3 [Theobroma cacao] EOY09052.1 Transport protein particle (TRAPP) component isoform 1 [Theobroma cacao] EOY09053.1 Transport protein particle (TRAPP) component isoform 1 [Theobroma cacao] Length = 186 Score = 159 bits (402), Expect = 6e-47 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAP APRSGDAIFASVERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPAAPRSGDAIFASVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85 >CDP05796.1 unnamed protein product [Coffea canephora] Length = 186 Score = 159 bits (401), Expect = 8e-47 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 M PVAPRSGDAIFASVERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MPPVAPRSGDAIFASVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85 >XP_002522846.1 PREDICTED: trafficking protein particle complex subunit 3 [Ricinus communis] EEF39544.1 Trafficking protein particle complex subunit, putative [Ricinus communis] Length = 186 Score = 159 bits (401), Expect = 8e-47 Identities = 80/85 (94%), Positives = 83/85 (97%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPV PRSGDAIFASVERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVGPRSGDAIFASVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 +DEFLAKSNV+ CVDFRETAEVIAK Sbjct: 61 VDEFLAKSNVNRCVDFRETAEVIAK 85 >XP_010272867.1 PREDICTED: trafficking protein particle complex subunit 3 [Nelumbo nucifera] XP_010272868.1 PREDICTED: trafficking protein particle complex subunit 3 [Nelumbo nucifera] Length = 186 Score = 158 bits (400), Expect = 1e-46 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDA+FA++ERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAVFANIERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSN+S CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNISRCVDFKETAEVIAK 85 >XP_012089644.1 PREDICTED: trafficking protein particle complex subunit 3-like [Jatropha curcas] KDP46828.1 hypothetical protein JCGZ_24037 [Jatropha curcas] Length = 186 Score = 158 bits (400), Expect = 1e-46 Identities = 80/85 (94%), Positives = 83/85 (97%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPV PRSGDAIFASVERVN+ELF+LTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVGPRSGDAIFASVERVNAELFSLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 +DEFLAKSNVS CVDFRETAEVIAK Sbjct: 61 VDEFLAKSNVSRCVDFRETAEVIAK 85 >XP_012070743.1 PREDICTED: trafficking protein particle complex subunit 3 [Jatropha curcas] KDP39056.1 hypothetical protein JCGZ_00813 [Jatropha curcas] Length = 186 Score = 158 bits (400), Expect = 1e-46 Identities = 80/85 (94%), Positives = 82/85 (96%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAP PRSGDAIFASVERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPAGPRSGDAIFASVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 +DEFLAKSNVS CVDFRETAEVIAK Sbjct: 61 VDEFLAKSNVSRCVDFRETAEVIAK 85 >XP_006347669.1 PREDICTED: trafficking protein particle complex subunit 3-like [Solanum tuberosum] Length = 186 Score = 158 bits (400), Expect = 1e-46 Identities = 80/85 (94%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEV+EVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVDEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85 >XP_012827478.1 PREDICTED: trafficking protein particle complex subunit 3-like [Erythranthe guttata] EYU19213.1 hypothetical protein MIMGU_mgv1a014703mg [Erythranthe guttata] Length = 181 Score = 158 bits (399), Expect = 1e-46 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAP+SGDAIFASV+RVN+ELFTLTYGAIVRQLLTDLEEV+EVNKQLDQMGYNIGIRL Sbjct: 1 MAPVAPKSGDAIFASVDRVNAELFTLTYGAIVRQLLTDLEEVDEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 +DEFLAKSNVS CVDFRETAEVIAK Sbjct: 61 VDEFLAKSNVSRCVDFRETAEVIAK 85 >XP_010105578.1 hypothetical protein L484_011896 [Morus notabilis] EXC05107.1 hypothetical protein L484_011896 [Morus notabilis] Length = 125 Score = 156 bits (394), Expect = 1e-46 Identities = 79/85 (92%), Positives = 81/85 (95%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAP PRSGDAIFASVERVN+ELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPAGPRSGDAIFASVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAE IAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAETIAK 85 >XP_020109386.1 trafficking protein particle complex subunit 3 [Ananas comosus] Length = 186 Score = 158 bits (399), Expect = 2e-46 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAP+APRSGDA+FASVERVN+ELFTLTYGAIVRQL+TDLEEVEEVNKQLDQMGYNIG+RL Sbjct: 1 MAPLAPRSGDAVFASVERVNAELFTLTYGAIVRQLITDLEEVEEVNKQLDQMGYNIGVRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85 >XP_019196898.1 PREDICTED: trafficking protein particle complex subunit 3 [Ipomoea nil] Length = 186 Score = 158 bits (399), Expect = 2e-46 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = +3 Query: 186 MAPVAPRSGDAIFASVERVNSELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 365 MAPVAPRSGDAIFA+VERVN+ELFTLTYGAIVRQLLTDLEEV+EVNKQLDQMGYNIG+RL Sbjct: 1 MAPVAPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVDEVNKQLDQMGYNIGVRL 60 Query: 366 IDEFLAKSNVSTCVDFRETAEVIAK 440 IDEFLAKSNVS CVDF+ETAEVIAK Sbjct: 61 IDEFLAKSNVSRCVDFKETAEVIAK 85