BLASTX nr result
ID: Panax24_contig00009395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009395 (887 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDY10766.1 BnaA05g11700D [Brassica napus] 121 9e-30 OIV93497.1 hypothetical protein TanjilG_11079 [Lupinus angustifo... 120 1e-29 EEF35731.1 Glycogen synthase kinase-3 beta, putative [Ricinus co... 121 3e-29 CAA72330.1 shaggy-like kinase, partial [Ricinus communis] 121 3e-29 EEC78696.1 hypothetical protein OsI_18849 [Oryza sativa Indica G... 120 5e-29 KDO77892.1 hypothetical protein CISIN_1g016950mg [Citrus sinensis] 121 5e-29 ACN27271.1 unknown [Zea mays] 118 6e-29 OIW14075.1 hypothetical protein TanjilG_11420 [Lupinus angustifo... 121 7e-29 XP_019166762.1 PREDICTED: shaggy-related protein kinase eta isof... 122 7e-29 XP_003596713.2 shaggy-like kinase dzeta [Medicago truncatula] AE... 122 8e-29 GAU26643.1 hypothetical protein TSUD_102530 [Trifolium subterran... 122 8e-29 XP_017235868.1 PREDICTED: shaggy-related protein kinase eta [Dau... 122 9e-29 XP_019166761.1 PREDICTED: shaggy-related protein kinase eta isof... 122 9e-29 XP_017229997.1 PREDICTED: shaggy-related protein kinase eta-like... 122 9e-29 XP_019166760.1 PREDICTED: shaggy-related protein kinase eta isof... 122 9e-29 XP_012573094.1 PREDICTED: shaggy-related protein kinase zeta iso... 122 1e-28 XP_017180614.1 PREDICTED: shaggy-related protein kinase eta [Mal... 121 1e-28 OAY24970.1 hypothetical protein MANES_17G057800 [Manihot esculenta] 121 1e-28 KDO77891.1 hypothetical protein CISIN_1g016950mg [Citrus sinensis] 121 1e-28 OIW08310.1 hypothetical protein TanjilG_02986 [Lupinus angustifo... 121 2e-28 >CDY10766.1 BnaA05g11700D [Brassica napus] Length = 224 Score = 121 bits (304), Expect = 9e-30 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 129 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 188 Query: 879 CS 884 C+ Sbjct: 189 CT 190 >OIV93497.1 hypothetical protein TanjilG_11079 [Lupinus angustifolius] Length = 180 Score = 120 bits (300), Expect = 1e-29 Identities = 54/62 (87%), Positives = 57/62 (91%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHK+FHK MPPEAIDLASRLL Y PSLR Sbjct: 87 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYLPSLR 146 Query: 879 CS 884 CS Sbjct: 147 CS 148 >EEF35731.1 Glycogen synthase kinase-3 beta, putative [Ricinus communis] Length = 266 Score = 121 bits (304), Expect = 3e-29 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 139 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 198 Query: 879 CS 884 C+ Sbjct: 199 CT 200 >CAA72330.1 shaggy-like kinase, partial [Ricinus communis] Length = 277 Score = 121 bits (304), Expect = 3e-29 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 150 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 209 Query: 879 CS 884 C+ Sbjct: 210 CT 211 >EEC78696.1 hypothetical protein OsI_18849 [Oryza sativa Indica Group] Length = 236 Score = 120 bits (300), Expect = 5e-29 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY +FRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 110 IIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 169 Query: 879 CS 884 C+ Sbjct: 170 CT 171 >KDO77892.1 hypothetical protein CISIN_1g016950mg [Citrus sinensis] Length = 296 Score = 121 bits (304), Expect = 5e-29 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 169 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 228 Query: 879 CS 884 C+ Sbjct: 229 CT 230 >ACN27271.1 unknown [Zea mays] Length = 191 Score = 118 bits (296), Expect = 6e-29 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY +FRFPQIKAHPWHK+FHK MPPEAIDLASRLL YSP+LR Sbjct: 64 IIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLR 123 Query: 879 CS 884 C+ Sbjct: 124 CT 125 >OIW14075.1 hypothetical protein TanjilG_11420 [Lupinus angustifolius] Length = 296 Score = 121 bits (303), Expect = 7e-29 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREE+RC+NPNY DFRFPQIKAHPWHK+FHK MPPEAIDLASRLL YSPSLR Sbjct: 169 IIKVLGTPTREEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLR 228 Query: 879 CS 884 CS Sbjct: 229 CS 230 >XP_019166762.1 PREDICTED: shaggy-related protein kinase eta isoform X3 [Ipomoea nil] Length = 366 Score = 122 bits (307), Expect = 7e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 CS Sbjct: 313 CS 314 >XP_003596713.2 shaggy-like kinase dzeta [Medicago truncatula] AES66964.2 shaggy-like kinase dzeta [Medicago truncatula] Length = 372 Score = 122 bits (307), Expect = 8e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 247 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 306 Query: 879 CS 884 CS Sbjct: 307 CS 308 >GAU26643.1 hypothetical protein TSUD_102530 [Trifolium subterraneum] Length = 355 Score = 122 bits (306), Expect = 8e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 227 IIKVLGTPTREEIRCMNPNYSDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 286 Query: 879 CS 884 CS Sbjct: 287 CS 288 >XP_017235868.1 PREDICTED: shaggy-related protein kinase eta [Daucus carota subsp. sativus] KZN07102.1 hypothetical protein DCAR_007939 [Daucus carota subsp. sativus] Length = 380 Score = 122 bits (307), Expect = 9e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 CS Sbjct: 313 CS 314 >XP_019166761.1 PREDICTED: shaggy-related protein kinase eta isoform X2 [Ipomoea nil] Length = 382 Score = 122 bits (307), Expect = 9e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 CS Sbjct: 313 CS 314 >XP_017229997.1 PREDICTED: shaggy-related protein kinase eta-like [Daucus carota subsp. sativus] Length = 382 Score = 122 bits (307), Expect = 9e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 CS Sbjct: 313 CS 314 >XP_019166760.1 PREDICTED: shaggy-related protein kinase eta isoform X1 [Ipomoea nil] Length = 383 Score = 122 bits (307), Expect = 9e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 CS Sbjct: 313 CS 314 >XP_012573094.1 PREDICTED: shaggy-related protein kinase zeta isoform X2 [Cicer arietinum] Length = 372 Score = 122 bits (306), Expect = 1e-28 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 247 IIKVLGTPTREEIRCMNPNYSDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 306 Query: 879 CS 884 CS Sbjct: 307 CS 308 >XP_017180614.1 PREDICTED: shaggy-related protein kinase eta [Malus domestica] Length = 339 Score = 121 bits (304), Expect = 1e-28 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 213 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 272 Query: 879 CS 884 C+ Sbjct: 273 CT 274 >OAY24970.1 hypothetical protein MANES_17G057800 [Manihot esculenta] Length = 348 Score = 121 bits (304), Expect = 1e-28 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 253 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 Query: 879 CS 884 C+ Sbjct: 313 CT 314 >KDO77891.1 hypothetical protein CISIN_1g016950mg [Citrus sinensis] Length = 353 Score = 121 bits (304), Expect = 1e-28 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQIKAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 226 IIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 285 Query: 879 CS 884 C+ Sbjct: 286 CT 287 >OIW08310.1 hypothetical protein TanjilG_02986 [Lupinus angustifolius] Length = 335 Score = 121 bits (303), Expect = 2e-28 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 699 IFQVLGTPTREEIRCLNPNYIDFRFPQIKAHPWHKVFHK*MPPEAIDLASRLLLYSPSLR 878 I +VLGTPTREEIRC+NPNY DFRFPQ+KAHPWHKVFHK MPPEAIDLASRLL YSPSLR Sbjct: 206 IIKVLGTPTREEIRCMNPNYTDFRFPQVKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 265 Query: 879 CS 884 C+ Sbjct: 266 CT 267