BLASTX nr result
ID: Panax24_contig00009237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009237 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236226.1 PREDICTED: F-box protein PP2-A12-like [Daucus car... 93 2e-20 XP_019156024.1 PREDICTED: F-box protein PP2-A12-like [Ipomoea nil] 88 1e-18 XP_015083253.1 PREDICTED: F-box protein PP2-A13-like [Solanum pe... 88 2e-18 XP_006358868.1 PREDICTED: F-box protein PP2-A12-like [Solanum tu... 88 2e-18 OIV93516.1 hypothetical protein TanjilG_28673 [Lupinus angustifo... 87 2e-18 XP_019422613.1 PREDICTED: F-box protein PP2-A12-like [Lupinus an... 87 3e-18 KVH90079.1 F-box domain, cyclin-like protein [Cynara cardunculus... 86 5e-18 XP_009609254.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 86 5e-18 NP_001316160.1 F-box protein PP2-B1 [Solanum lycopersicum] 86 8e-18 XP_009765736.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 86 1e-17 XP_019231024.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 84 3e-17 XP_017232961.1 PREDICTED: F-box protein PP2-A12 [Daucus carota s... 84 4e-17 XP_016507627.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 84 6e-17 XP_009761469.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 84 6e-17 XP_017427695.1 PREDICTED: F-box protein PP2-A12 [Vigna angularis... 83 1e-16 CDP09805.1 unnamed protein product [Coffea canephora] 83 1e-16 XP_016509402.1 PREDICTED: F-box protein PP2-A13-like [Nicotiana ... 82 3e-16 XP_009593081.1 PREDICTED: F-box protein PP2-A13-like [Nicotiana ... 82 3e-16 XP_019266486.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana ... 81 4e-16 XP_002509712.1 PREDICTED: F-box protein PP2-A12 [Ricinus communi... 81 5e-16 >XP_017236226.1 PREDICTED: F-box protein PP2-A12-like [Daucus carota subsp. sativus] KZN05922.1 hypothetical protein DCAR_006759 [Daucus carota subsp. sativus] Length = 284 Score = 92.8 bits (229), Expect = 2e-20 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGAS ADFVWESKLP NY+SLIQ+LFD FP NLCK+D+Y+ LCR NSFDGGT Sbjct: 53 RGASYADFVWESKLPLNYESLIQKLFDKFPENLCKKDIYACLCRPNSFDGGT 104 >XP_019156024.1 PREDICTED: F-box protein PP2-A12-like [Ipomoea nil] Length = 284 Score = 87.8 bits (216), Expect = 1e-18 Identities = 42/54 (77%), Positives = 47/54 (87%), Gaps = 2/54 (3%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDD--FPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP+NY SLIQR+F+D FP NLCKRD+Y+ LC NSFDGGT Sbjct: 55 RGASSADFVWESKLPANYASLIQRVFEDKEFPVNLCKRDIYARLCVPNSFDGGT 108 >XP_015083253.1 PREDICTED: F-box protein PP2-A13-like [Solanum pennellii] Length = 289 Score = 87.8 bits (216), Expect = 2e-18 Identities = 41/54 (75%), Positives = 47/54 (87%), Gaps = 2/54 (3%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDD--FPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+IQR+F D FP+NLCKRD+Y+ LCR NSFDGG+ Sbjct: 55 RGASSADFVWESKLPMNYTSIIQRVFADRNFPANLCKRDIYAKLCRPNSFDGGS 108 >XP_006358868.1 PREDICTED: F-box protein PP2-A12-like [Solanum tuberosum] Length = 289 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/54 (74%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF--DDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+IQR+F +FP+NLCKRD+Y++LCR NSFDGG+ Sbjct: 55 RGASSADFVWESKLPMNYSSIIQRVFAGRNFPANLCKRDIYAMLCRPNSFDGGS 108 >OIV93516.1 hypothetical protein TanjilG_28673 [Lupinus angustifolius] Length = 273 Score = 87.0 bits (214), Expect = 2e-18 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLPSNYD L++++FDDFPS+L R +Y+ LCR NSFDGGT Sbjct: 39 RGASSADFVWESKLPSNYDVLVRKIFDDFPSDLGMRGIYARLCRVNSFDGGT 90 >XP_019422613.1 PREDICTED: F-box protein PP2-A12-like [Lupinus angustifolius] Length = 290 Score = 87.0 bits (214), Expect = 3e-18 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLPSNYD L++++FDDFPS+L R +Y+ LCR NSFDGGT Sbjct: 56 RGASSADFVWESKLPSNYDVLVRKIFDDFPSDLGMRGIYARLCRVNSFDGGT 107 >KVH90079.1 F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 279 Score = 86.3 bits (212), Expect = 5e-18 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY+S+I R+FD+FPS+LCK+D+Y++L R NS DG T Sbjct: 57 RGASSADFVWESKLPENYESVISRVFDEFPSDLCKKDIYAILSRPNSIDGNT 108 >XP_009609254.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana tomentosiformis] XP_016441114.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana tabacum] Length = 281 Score = 86.3 bits (212), Expect = 5e-18 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+IQR+ +FP+NLCKRD+Y+ LCR NSFDGGT Sbjct: 50 RGASSADFVWESKLPLNYSSIIQRV-QNFPNNLCKRDIYARLCRPNSFDGGT 100 >NP_001316160.1 F-box protein PP2-B1 [Solanum lycopersicum] Length = 289 Score = 85.9 bits (211), Expect = 8e-18 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 2/54 (3%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF--DDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+IQR+F +FP+NLCKRD+Y+ LCR NSFDGG+ Sbjct: 55 RGASSADFVWESKLPMNYTSIIQRVFAGRNFPANLCKRDIYAKLCRPNSFDGGS 108 >XP_009765736.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana sylvestris] XP_016471847.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana tabacum] Length = 281 Score = 85.5 bits (210), Expect = 1e-17 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+IQR+ +FP+NLCKRD+Y+ LCR NSFDGGT Sbjct: 50 RGASSADFVWESKLPLNYASIIQRV-QNFPNNLCKRDIYARLCRPNSFDGGT 100 >XP_019231024.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana attenuata] OIT29036.1 f-box protein pp2-a12 [Nicotiana attenuata] Length = 290 Score = 84.3 bits (207), Expect = 3e-17 Identities = 40/55 (72%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF---DDFPSNLCKRDMYSLLCRSNSFDGGT 354 R ASSADFVWESKLP NY SLI R+F D+FP+NLCKRD+Y+ LCR N FDGGT Sbjct: 56 RAASSADFVWESKLPLNYGSLIDRVFGDDDNFPTNLCKRDIYATLCRPNYFDGGT 110 >XP_017232961.1 PREDICTED: F-box protein PP2-A12 [Daucus carota subsp. sativus] KZN07921.1 hypothetical protein DCAR_000590 [Daucus carota subsp. sativus] Length = 279 Score = 84.0 bits (206), Expect = 4e-17 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGG 351 RGA+SADFVWESKLP NYD + +RLF DFP +CK+D+YS+LC NSFD G Sbjct: 49 RGAASADFVWESKLPVNYDEIFRRLFGDFPKEICKKDLYSVLCHPNSFDDG 99 >XP_016507627.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana tabacum] Length = 290 Score = 83.6 bits (205), Expect = 6e-17 Identities = 40/55 (72%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF---DDFPSNLCKRDMYSLLCRSNSFDGGT 354 R ASSADFVWESKLP NY SLI R+F D+FP+NLCKRD+Y+ LCR N FDGGT Sbjct: 56 RDASSADFVWESKLPLNYGSLIDRVFAADDNFPTNLCKRDIYARLCRPNYFDGGT 110 >XP_009761469.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana sylvestris] Length = 290 Score = 83.6 bits (205), Expect = 6e-17 Identities = 40/55 (72%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF---DDFPSNLCKRDMYSLLCRSNSFDGGT 354 R ASSADFVWESKLP NY SLI R+F D+FP+NLCKRD+Y+ LCR N FDGGT Sbjct: 56 RDASSADFVWESKLPLNYGSLIDRVFAADDNFPTNLCKRDIYARLCRPNYFDGGT 110 >XP_017427695.1 PREDICTED: F-box protein PP2-A12 [Vigna angularis] KOM32677.1 hypothetical protein LR48_Vigan01g223300 [Vigna angularis] BAT75951.1 hypothetical protein VIGAN_01389000 [Vigna angularis var. angularis] Length = 283 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLPSNY L++R+FDDFPS+L KR +Y+ LCR NS D GT Sbjct: 49 RGASSADFVWESKLPSNYSVLLRRIFDDFPSHLGKRGIYARLCRLNSLDDGT 100 >CDP09805.1 unnamed protein product [Coffea canephora] Length = 297 Score = 82.8 bits (203), Expect = 1e-16 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 8/60 (13%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLFDD--------FPSNLCKRDMYSLLCRSNSFDGGT 354 RGASSADFVWESKLP NY S+I R+ DD FP NLCKRD+YS LCR SFDGGT Sbjct: 55 RGASSADFVWESKLPLNYGSVIDRVADDGWKQGCDDFPKNLCKRDIYSRLCRPKSFDGGT 114 >XP_016509402.1 PREDICTED: F-box protein PP2-A13-like [Nicotiana tabacum] Length = 291 Score = 81.6 bits (200), Expect = 3e-16 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF----DDFPSNLCKRDMYSLLCRSNSFDGGT 354 R ASSADFVWESKLP NY SLI R+F ++FP+NLCKRD+Y+ LCR N FDGGT Sbjct: 56 RDASSADFVWESKLPLNYGSLIDRVFVDDDENFPTNLCKRDVYARLCRPNYFDGGT 111 >XP_009593081.1 PREDICTED: F-box protein PP2-A13-like [Nicotiana tomentosiformis] Length = 291 Score = 81.6 bits (200), Expect = 3e-16 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF----DDFPSNLCKRDMYSLLCRSNSFDGGT 354 R ASSADFVWESKLP NY SLI R+F ++FP+NLCKRD+Y+ LCR N FDGGT Sbjct: 56 RDASSADFVWESKLPLNYGSLIDRVFVDDDENFPTNLCKRDVYARLCRPNYFDGGT 111 >XP_019266486.1 PREDICTED: F-box protein PP2-A12-like [Nicotiana attenuata] OIT35003.1 f-box protein pp2-a12 [Nicotiana attenuata] Length = 281 Score = 81.3 bits (199), Expect = 4e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 205 ASSADFVWESKLPSNYDSLIQRLFDDFPSNLCKRDMYSLLCRSNSFDGGT 354 ASSADFVWESKLP NY S+IQR+ +FP+NLCKRD+Y+ LCR NSFDGGT Sbjct: 52 ASSADFVWESKLPLNYASIIQRV-QNFPNNLCKRDIYARLCRPNSFDGGT 100 >XP_002509712.1 PREDICTED: F-box protein PP2-A12 [Ricinus communis] EEF51099.1 ATPP2-A13, putative [Ricinus communis] Length = 301 Score = 81.3 bits (199), Expect = 5e-16 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Frame = +1 Query: 199 RGASSADFVWESKLPSNYDSLIQRLF---DDFPSNLCKRDMYSLLCRSNSFDGGT 354 RGAS ADFVWESKLPSNY SL++R+F DDFP L KR++Y++LCR+N+FDGGT Sbjct: 67 RGASWADFVWESKLPSNYVSLLERVFGGDDDFPRKLNKREIYTILCRANTFDGGT 121