BLASTX nr result
ID: Panax24_contig00009175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009175 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10293.1 hypothetical protein DCAR_002949 [Daucus carota subsp... 62 1e-09 XP_017250656.1 PREDICTED: uncharacterized protein LOC108221248 [... 62 2e-09 >KZN10293.1 hypothetical protein DCAR_002949 [Daucus carota subsp. sativus] Length = 160 Score = 62.0 bits (149), Expect = 1e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 TPFRGGPQDRVETPKSSKKEEDEDNWELPEGG 117 TPFR GP +RV+T KSSKKEEDEDNWELP+GG Sbjct: 126 TPFRAGPPERVDTAKSSKKEEDEDNWELPQGG 157 >XP_017250656.1 PREDICTED: uncharacterized protein LOC108221248 [Daucus carota subsp. sativus] Length = 173 Score = 62.0 bits (149), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 TPFRGGPQDRVETPKSSKKEEDEDNWELPEGG 117 TPFR GP +RV+T KSSKKEEDEDNWELP+GG Sbjct: 139 TPFRAGPPERVDTAKSSKKEEDEDNWELPQGG 170