BLASTX nr result
ID: Panax24_contig00009104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009104 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019156536.1 PREDICTED: probable rhamnogalacturonate lyase B i... 109 2e-25 XP_019156535.1 PREDICTED: probable rhamnogalacturonate lyase B i... 109 2e-25 XP_019156534.1 PREDICTED: probable rhamnogalacturonate lyase B i... 109 2e-25 XP_019237626.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 6e-25 XP_019237625.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_016453917.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_010320230.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_019237627.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_015165703.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_009626137.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_006338131.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_004238020.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 8e-25 XP_018633405.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 9e-25 XP_016453916.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 9e-25 OIT22286.1 hypothetical protein A4A49_38483 [Nicotiana attenuata] 107 9e-25 XP_011098619.1 PREDICTED: probable rhamnogalacturonate lyase B i... 107 1e-24 XP_016514955.1 PREDICTED: probable rhamnogalacturonate lyase B [... 106 2e-24 XP_009803162.1 PREDICTED: probable rhamnogalacturonate lyase B [... 106 2e-24 XP_019156537.1 PREDICTED: probable rhamnogalacturonate lyase B [... 106 3e-24 XP_015073522.1 PREDICTED: probable rhamnogalacturonate lyase B [... 106 3e-24 >XP_019156536.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Ipomoea nil] Length = 565 Score = 109 bits (272), Expect = 2e-25 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHGWIC DPPVGFWQITPSNEFRTGGP KQD Sbjct: 125 FKGEVDDKYQYSCENKDNKVHGWICFDPPVGFWQITPSNEFRTGGPFKQD 174 >XP_019156535.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Ipomoea nil] Length = 639 Score = 109 bits (272), Expect = 2e-25 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHGWIC DPPVGFWQITPSNEFRTGGP KQD Sbjct: 199 FKGEVDDKYQYSCENKDNKVHGWICFDPPVGFWQITPSNEFRTGGPFKQD 248 >XP_019156534.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Ipomoea nil] Length = 645 Score = 109 bits (272), Expect = 2e-25 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHGWIC DPPVGFWQITPSNEFRTGGP KQD Sbjct: 205 FKGEVDDKYQYSCENKDNKVHGWICFDPPVGFWQITPSNEFRTGGPFKQD 254 >XP_019237626.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana attenuata] Length = 506 Score = 107 bits (268), Expect = 6e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 63 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 112 >XP_019237625.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana attenuata] Length = 603 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 160 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 209 >XP_016453917.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana tabacum] Length = 606 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_010320230.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Solanum lycopersicum] Length = 621 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 178 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 227 >XP_019237627.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Nicotiana attenuata] Length = 643 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 200 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 249 >XP_015165703.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Solanum tuberosum] Length = 648 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_009626137.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana tomentosiformis] Length = 650 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_006338131.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Solanum tuberosum] Length = 650 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_004238020.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Solanum lycopersicum] Length = 650 Score = 107 bits (268), Expect = 8e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_018633405.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana tomentosiformis] Length = 653 Score = 107 bits (268), Expect = 9e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >XP_016453916.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana tabacum] Length = 658 Score = 107 bits (268), Expect = 9e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256 >OIT22286.1 hypothetical protein A4A49_38483 [Nicotiana attenuata] Length = 1213 Score = 107 bits (268), Expect = 9e-25 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 160 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 209 >XP_011098619.1 PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Sesamum indicum] Length = 589 Score = 107 bits (267), Expect = 1e-24 Identities = 50/80 (62%), Positives = 56/80 (70%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQDQFA*SSLSES 265 F GEVDDKYQY CENKDN+VHGWIC DPPVGFWQITPSNEFR GGP KQD + + + Sbjct: 199 FKGEVDDKYQYSCENKDNQVHGWICFDPPVGFWQITPSNEFRNGGPFKQDLTSHVNPTTL 258 Query: 266 AMAKRELSSTLKNLKVQQWP 325 AM K +V+ WP Sbjct: 259 AMKK----------EVESWP 268 >XP_016514955.1 PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana tabacum] Length = 662 Score = 106 bits (265), Expect = 2e-24 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFW+ITPSNEFRTGGP+KQD Sbjct: 204 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWEITPSNEFRTGGPIKQD 253 >XP_009803162.1 PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris] Length = 662 Score = 106 bits (265), Expect = 2e-24 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+ICLDPPVGFW+ITPSNEFRTGGP+KQD Sbjct: 204 FKGEVDDKYQYSCENKDNKVHGFICLDPPVGFWEITPSNEFRTGGPIKQD 253 >XP_019156537.1 PREDICTED: probable rhamnogalacturonate lyase B [Ipomoea nil] XP_019156538.1 PREDICTED: probable rhamnogalacturonate lyase B [Ipomoea nil] Length = 641 Score = 106 bits (264), Expect = 3e-24 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDNKVHG+IC DPPVGFWQITPSNEFRTGGP+KQD Sbjct: 199 FKGEVDDKYQYSCENKDNKVHGFICFDPPVGFWQITPSNEFRTGGPIKQD 248 >XP_015073522.1 PREDICTED: probable rhamnogalacturonate lyase B [Solanum pennellii] Length = 650 Score = 106 bits (264), Expect = 3e-24 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 86 FLGEVDDKYQYMCENKDNKVHGWICLDPPVGFWQITPSNEFRTGGPLKQD 235 F GEVDDKYQY CENKDN+VHG+ICLDPPVGFWQITPSNEFRTGGP+KQD Sbjct: 207 FKGEVDDKYQYSCENKDNQVHGFICLDPPVGFWQITPSNEFRTGGPIKQD 256