BLASTX nr result
ID: Panax24_contig00009076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009076 (715 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019455778.1 PREDICTED: protein ODORANT1-like [Lupinus angusti... 65 4e-10 AET81969.1 hypothetical protein, partial [Pinus contorta var. bo... 63 1e-09 XP_016443010.1 PREDICTED: protein ODORANT1-like [Nicotiana tabacum] 63 1e-09 BAN09111.1 myb transcription factor, partial [Artemisia indica] 63 1e-09 KZV17164.1 myb-related protein 315 [Dorcoceras hygrometricum] 67 1e-09 EEF30471.1 r2r3-myb transcription factor, putative [Ricinus comm... 63 2e-09 XP_017241175.1 PREDICTED: myb-related protein 315-like [Daucus c... 66 2e-09 XP_010248826.1 PREDICTED: myb-related protein 315-like [Nelumbo ... 66 2e-09 XP_010424128.1 PREDICTED: protein ODORANT1-like [Camelina sativa] 65 3e-09 XP_002960429.1 hypothetical protein SELMODRAFT_39499, partial [S... 62 3e-09 XP_012071273.1 PREDICTED: protein ODORANT1-like [Jatropha curcas] 62 4e-09 KGN63546.1 hypothetical protein Csa_1G004120 [Cucumis sativus] 62 4e-09 KMZ74899.1 hypothetical protein ZOSMA_121G00750 [Zostera marina] 65 5e-09 XP_010525304.2 PREDICTED: protein ODORANT1-like, partial [Tarena... 63 5e-09 XP_017245557.1 PREDICTED: myb-related protein 315-like [Daucus c... 65 6e-09 ABD60296.2 R2R3-MYB transcription factor MYB1, partial [Picea gl... 63 6e-09 XP_009408320.1 PREDICTED: protein ODORANT1-like [Musa acuminata ... 65 6e-09 KDO52079.1 hypothetical protein CISIN_1g041165mg, partial [Citru... 61 6e-09 XP_019455773.1 PREDICTED: protein ODORANT1-like isoform X2 [Lupi... 65 6e-09 AAL84620.1 typical P-type R2R3 Myb protein, partial [Zea mays] 63 8e-09 >XP_019455778.1 PREDICTED: protein ODORANT1-like [Lupinus angustifolius] Length = 104 Score = 65.1 bits (157), Expect = 4e-10 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGLLSEYEE 75 >AET81969.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81970.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81971.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81972.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81973.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81974.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81975.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81976.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81977.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81978.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81979.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81980.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81981.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81982.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81983.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81984.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81985.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81986.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81987.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81988.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81989.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81990.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81991.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81992.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81993.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81994.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81995.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81996.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81997.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81998.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81999.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82000.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82001.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82002.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82003.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82004.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82005.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82006.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82007.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82008.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82009.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82010.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82011.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82012.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82013.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82014.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82015.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82016.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82017.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82018.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82019.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82020.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82021.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82022.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82023.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82024.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82025.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82026.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82027.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82028.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82029.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82030.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82031.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82032.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82033.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82034.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82035.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82036.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82037.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82038.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82039.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82040.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82041.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82042.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82043.1 hypothetical protein, partial [Pinus contorta var. murrayana] Length = 87 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSESEE 75 >XP_016443010.1 PREDICTED: protein ODORANT1-like [Nicotiana tabacum] Length = 88 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSEYEE 75 >BAN09111.1 myb transcription factor, partial [Artemisia indica] Length = 78 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 27 GLLRCGKSCRLRWTNYLRPDLKRGLLSENEE 57 >KZV17164.1 myb-related protein 315 [Dorcoceras hygrometricum] Length = 283 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG++SEMEE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGVLSEMEE 75 >EEF30471.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 98 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSEYEE 75 >XP_017241175.1 PREDICTED: myb-related protein 315-like [Daucus carota subsp. sativus] KZN02532.1 hypothetical protein DCAR_011286 [Daucus carota subsp. sativus] Length = 258 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRGM+SE EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGMLSETEE 75 >XP_010248826.1 PREDICTED: myb-related protein 315-like [Nelumbo nucifera] Length = 259 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG +SEMEE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGALSEMEE 75 >XP_010424128.1 PREDICTED: protein ODORANT1-like [Camelina sativa] Length = 201 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGLLSEYEE 75 >XP_002960429.1 hypothetical protein SELMODRAFT_39499, partial [Selaginella moellendorffii] XP_002967288.1 hypothetical protein SELMODRAFT_39496, partial [Selaginella moellendorffii] EFJ31887.1 hypothetical protein SELMODRAFT_39496, partial [Selaginella moellendorffii] EFJ37968.1 hypothetical protein SELMODRAFT_39499, partial [Selaginella moellendorffii] Length = 87 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG+++E EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGVLTEQEE 75 >XP_012071273.1 PREDICTED: protein ODORANT1-like [Jatropha curcas] Length = 88 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG +E+EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGGFTEVEE 75 >KGN63546.1 hypothetical protein Csa_1G004120 [Cucumis sativus] Length = 88 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GL RCGKSCRLRWINYLRPDLKRGM S+ EE Sbjct: 45 GLERCGKSCRLRWINYLRPDLKRGMFSQQEE 75 >KMZ74899.1 hypothetical protein ZOSMA_121G00750 [Zostera marina] Length = 217 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRGM+S+ +E Sbjct: 46 GLLRCGKSCRLRWINYLRPDLKRGMISDSDE 76 >XP_010525304.2 PREDICTED: protein ODORANT1-like, partial [Tarenaya hassleriana] Length = 144 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSEYEE 75 >XP_017245557.1 PREDICTED: myb-related protein 315-like [Daucus carota subsp. sativus] Length = 259 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRGM+SE E+ Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGMLSEAEQ 75 >ABD60296.2 R2R3-MYB transcription factor MYB1, partial [Picea glauca] Length = 154 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSESEE 75 >XP_009408320.1 PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis] Length = 266 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGLLSESEE 75 >KDO52079.1 hypothetical protein CISIN_1g041165mg, partial [Citrus sinensis] Length = 85 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG +E EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGAFTEDEE 75 >XP_019455773.1 PREDICTED: protein ODORANT1-like isoform X2 [Lupinus angustifolius] Length = 272 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRWINYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWINYLRPDLKRGLLSEYEE 75 >AAL84620.1 typical P-type R2R3 Myb protein, partial [Zea mays] Length = 150 Score = 62.8 bits (151), Expect = 8e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 621 GLLRCGKSCRLRWINYLRPDLKRGMVSEMEE 713 GLLRCGKSCRLRW NYLRPDLKRG++SE EE Sbjct: 45 GLLRCGKSCRLRWTNYLRPDLKRGLLSEEEE 75