BLASTX nr result
ID: Panax24_contig00009075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00009075 (1106 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222556.1 PREDICTED: WD repeat-containing protein 26-like [... 59 7e-06 >XP_017222556.1 PREDICTED: WD repeat-containing protein 26-like [Daucus carota subsp. sativus] KZM85707.1 hypothetical protein DCAR_026871 [Daucus carota subsp. sativus] Length = 579 Score = 58.9 bits (141), Expect = 7e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 923 QRDDETVGLKVIIKTQEYIRIITQALYSLGFKKATTLVEEE 1045 QRDDET+GLK IIK E+++II +ALYSLG+ K T++EEE Sbjct: 46 QRDDETIGLKGIIKKHEFVKIINRALYSLGYSKTATILEEE 86