BLASTX nr result
ID: Panax24_contig00008714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00008714 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010097097.1 hypothetical protein L484_019536 [Morus notabilis... 55 1e-06 >XP_010097097.1 hypothetical protein L484_019536 [Morus notabilis] EXB66898.1 hypothetical protein L484_019536 [Morus notabilis] Length = 110 Score = 55.1 bits (131), Expect = 1e-06 Identities = 31/63 (49%), Positives = 36/63 (57%) Frame = +3 Query: 432 QILSADPKIKATNVSAQPTANDGEIDPAEAVGLGAGASAAREVPTREKTVAITATRAIEA 611 Q L +PK +AT + + NDGEI A GLGAG SAA P E+TV ITA RA Sbjct: 30 QALREEPKTRATRAAKKAERNDGEIAAAGEAGLGAGDSAAWVAPMMERTVKITAARATTE 89 Query: 612 AME 620 A E Sbjct: 90 ACE 92