BLASTX nr result
ID: Panax24_contig00008613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00008613 (586 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY47867.1 hypothetical protein MANES_06G111900 [Manihot esculenta] 87 5e-17 XP_010663078.1 PREDICTED: rhodanese-like domain-containing prote... 85 6e-17 XP_010251005.1 PREDICTED: rhodanese-like domain-containing prote... 86 9e-17 XP_002276527.1 PREDICTED: rhodanese-like domain-containing prote... 85 2e-16 XP_007137992.1 hypothetical protein PHAVU_009G171900g [Phaseolus... 85 2e-16 XP_004501853.1 PREDICTED: rhodanese-like domain-containing prote... 85 2e-16 XP_018505918.1 PREDICTED: rhodanese-like domain-containing prote... 81 3e-16 OMO50916.1 hypothetical protein COLO4_37865 [Corchorus olitorius] 82 5e-16 XP_002322209.1 hypothetical protein POPTR_0015s09770g [Populus t... 84 5e-16 XP_011005614.1 PREDICTED: rhodanese-like domain-containing prote... 83 6e-16 EEF51894.1 conserved hypothetical protein [Ricinus communis] 84 7e-16 XP_015581911.1 PREDICTED: rhodanese-like domain-containing prote... 84 7e-16 XP_019182012.1 PREDICTED: rhodanese-like domain-containing prote... 84 7e-16 XP_015581907.1 PREDICTED: rhodanese-like domain-containing prote... 84 7e-16 KYP69599.1 hypothetical protein KK1_008796 [Cajanus cajan] 83 8e-16 XP_017185855.1 PREDICTED: rhodanese-like domain-containing prote... 80 9e-16 XP_012079953.1 PREDICTED: rhodanese-like domain-containing prote... 83 1e-15 XP_012079952.1 PREDICTED: rhodanese-like domain-containing prote... 83 1e-15 XP_011005613.1 PREDICTED: rhodanese-like domain-containing prote... 83 1e-15 XP_011071993.1 PREDICTED: rhodanese-like domain-containing prote... 81 1e-15 >OAY47867.1 hypothetical protein MANES_06G111900 [Manihot esculenta] Length = 295 Score = 86.7 bits (213), Expect = 5e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAAAK GWGYRL+FSARLVG+F+V DALF+GAQQVS Y+QDIRSH Sbjct: 247 DQQRVAAAKEGWGYRLLFSARLVGVFLVADALFLGAQQVSRYIQDIRSH 295 >XP_010663078.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Vitis vinifera] Length = 220 Score = 85.1 bits (209), Expect = 6e-17 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAA K GWGYRLVFSARLVG+F+V DALFIGAQQ+ YLQDIRSH Sbjct: 172 DQQRVAATKEGWGYRLVFSARLVGVFLVADALFIGAQQLGRYLQDIRSH 220 >XP_010251005.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Nelumbo nucifera] Length = 293 Score = 85.9 bits (211), Expect = 9e-17 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRLVFSARLVG+FIV DALFIGAQQV YLQD+RSH Sbjct: 245 DQQRAAAAKEGWGYRLVFSARLVGLFIVADALFIGAQQVGRYLQDLRSH 293 >XP_002276527.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X1 [Vitis vinifera] CBI14916.3 unnamed protein product, partial [Vitis vinifera] Length = 286 Score = 85.1 bits (209), Expect = 2e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAA K GWGYRLVFSARLVG+F+V DALFIGAQQ+ YLQDIRSH Sbjct: 238 DQQRVAATKEGWGYRLVFSARLVGVFLVADALFIGAQQLGRYLQDIRSH 286 >XP_007137992.1 hypothetical protein PHAVU_009G171900g [Phaseolus vulgaris] ESW09986.1 hypothetical protein PHAVU_009G171900g [Phaseolus vulgaris] Length = 287 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRLVFSARL+G+F+V D L+IGAQQ+ HYLQDIR+H Sbjct: 239 DQQRAAAAKEGWGYRLVFSARLIGVFLVADVLYIGAQQIGHYLQDIRTH 287 >XP_004501853.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Cicer arietinum] Length = 292 Score = 84.7 bits (208), Expect = 2e-16 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRLVFSARL+G+F+V DALFIGAQQ+ HYLQ+IR+H Sbjct: 244 DQQRAAAAKEGWGYRLVFSARLIGLFLVTDALFIGAQQLGHYLQEIRTH 292 >XP_018505918.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic, partial [Pyrus x bretschneideri] Length = 134 Score = 80.9 bits (198), Expect = 3e-16 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GW YRLVFSARLVG+ I+ DALF GAQQ HYLQDIRSH Sbjct: 84 DQQRAAAAKEGWSYRLVFSARLVGVIILADALFFGAQQFGHYLQDIRSH 132 >OMO50916.1 hypothetical protein COLO4_37865 [Corchorus olitorius] Length = 191 Score = 82.0 bits (201), Expect = 5e-16 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRV AA+ GWGYRL++SARLVG+ +V DALFIGAQQV HYLQ+IRSH Sbjct: 143 DQQRVQAAREGWGYRLLYSARLVGVIVVADALFIGAQQVGHYLQEIRSH 191 >XP_002322209.1 hypothetical protein POPTR_0015s09770g [Populus trichocarpa] EEF06336.1 hypothetical protein POPTR_0015s09770g [Populus trichocarpa] Length = 296 Score = 84.0 bits (206), Expect = 5e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRL+FSARLVGIF+V DALFIGAQQV Y+QD+RSH Sbjct: 248 DQQRAAAAKEGWGYRLLFSARLVGIFLVADALFIGAQQVGRYIQDLRSH 296 >XP_011005614.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Populus euphratica] Length = 244 Score = 82.8 bits (203), Expect = 6e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRL+FSARLVGIF+V DALFIGAQQV Y+QD+RSH Sbjct: 196 DQQRAAAAKEGWGYRLLFSARLVGIFLVADALFIGAQQVGCYIQDLRSH 244 >EEF51894.1 conserved hypothetical protein [Ricinus communis] Length = 294 Score = 83.6 bits (205), Expect = 7e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAAAK GWGYRL+FSARLVG+ +V DALF+GAQQVS Y QDIRSH Sbjct: 246 DQQRVAAAKEGWGYRLLFSARLVGVILVADALFLGAQQVSRYFQDIRSH 294 >XP_015581911.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Ricinus communis] Length = 295 Score = 83.6 bits (205), Expect = 7e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAAAK GWGYRL+FSARLVG+ +V DALF+GAQQVS Y QDIRSH Sbjct: 247 DQQRVAAAKEGWGYRLLFSARLVGVILVADALFLGAQQVSRYFQDIRSH 295 >XP_019182012.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Ipomoea nil] Length = 296 Score = 83.6 bits (205), Expect = 7e-16 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAAAK GWGYRLVFSARLVG+F+V DALFIGAQ+V Y+QD+R+H Sbjct: 248 DQQRVAAAKEGWGYRLVFSARLVGVFLVADALFIGAQRVGQYIQDLRTH 296 >XP_015581907.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X1 [Ricinus communis] Length = 296 Score = 83.6 bits (205), Expect = 7e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQRVAAAK GWGYRL+FSARLVG+ +V DALF+GAQQVS Y QDIRSH Sbjct: 248 DQQRVAAAKEGWGYRLLFSARLVGVILVADALFLGAQQVSRYFQDIRSH 296 >KYP69599.1 hypothetical protein KK1_008796 [Cajanus cajan] Length = 282 Score = 83.2 bits (204), Expect = 8e-16 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 EQQR AAAK GWGYRLVFSARL+G+F+V DAL+IGAQQ+ YLQDI++H Sbjct: 234 EQQRAAAAKEGWGYRLVFSARLIGVFLVADALYIGAQQIGRYLQDIKTH 282 >XP_017185855.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic, partial [Malus domestica] Length = 131 Score = 79.7 bits (195), Expect = 9e-16 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR A AK GW YRLVFSARLVG+ ++ DALF+GAQQ HYLQDIRSH Sbjct: 83 DQQRAAGAKEGWSYRLVFSARLVGVIVLADALFLGAQQFGHYLQDIRSH 131 >XP_012079953.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Jatropha curcas] KDP31008.1 hypothetical protein JCGZ_11384 [Jatropha curcas] Length = 295 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRL+FSARL+G+F+V DALF+GAQQV Y+QDIRSH Sbjct: 247 DQQRAAAAKEGWGYRLLFSARLIGVFLVADALFLGAQQVGRYIQDIRSH 295 >XP_012079952.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X1 [Jatropha curcas] Length = 296 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRL+FSARL+G+F+V DALF+GAQQV Y+QDIRSH Sbjct: 248 DQQRAAAAKEGWGYRLLFSARLIGVFLVADALFLGAQQVGRYIQDIRSH 296 >XP_011005613.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X1 [Populus euphratica] Length = 296 Score = 82.8 bits (203), Expect = 1e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRSH 460 +QQR AAAK GWGYRL+FSARLVGIF+V DALFIGAQQV Y+QD+RSH Sbjct: 248 DQQRAAAAKEGWGYRLLFSARLVGIFLVADALFIGAQQVGCYIQDLRSH 296 >XP_011071993.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic isoform X2 [Sesamum indicum] Length = 215 Score = 81.3 bits (199), Expect = 1e-15 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 314 EQQRVAAAK*GWGYRLVFSARLVGIFIVVDALFIGAQQVSHYLQDIRS 457 +QQR AAAK GWGYRLVFSARLVG+F+V DALF+GAQQV YLQD+RS Sbjct: 167 DQQRAAAAKEGWGYRLVFSARLVGLFLVADALFLGAQQVGRYLQDLRS 214