BLASTX nr result
ID: Panax24_contig00008095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00008095 (694 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215379.1 PREDICTED: mitogen-activated protein kinase kinas... 58 4e-06 KZM87460.1 hypothetical protein DCAR_024594 [Daucus carota subsp... 58 4e-06 XP_017215378.1 PREDICTED: mitogen-activated protein kinase kinas... 58 4e-06 XP_010093989.1 Mitogen-activated protein kinase kinase kinase 3 ... 57 9e-06 >XP_017215379.1 PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like isoform X2 [Daucus carota subsp. sativus] Length = 679 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 344 FL*PMWFREPDFRPTALDLLQHPFVTGEYQEAQPVYRT*VL 222 FL +EPD+RPTA DLLQHPFVTGEYQE+ PV RT V+ Sbjct: 307 FLLKCLHKEPDWRPTASDLLQHPFVTGEYQESLPVNRTSVI 347 >KZM87460.1 hypothetical protein DCAR_024594 [Daucus carota subsp. sativus] Length = 684 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 344 FL*PMWFREPDFRPTALDLLQHPFVTGEYQEAQPVYRT*VL 222 FL +EPD+RPTA DLLQHPFVTGEYQE+ PV RT V+ Sbjct: 307 FLLKCLHKEPDWRPTASDLLQHPFVTGEYQESLPVNRTSVI 347 >XP_017215378.1 PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like isoform X1 [Daucus carota subsp. sativus] Length = 690 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 344 FL*PMWFREPDFRPTALDLLQHPFVTGEYQEAQPVYRT*VL 222 FL +EPD+RPTA DLLQHPFVTGEYQE+ PV RT V+ Sbjct: 307 FLLKCLHKEPDWRPTASDLLQHPFVTGEYQESLPVNRTSVI 347 >XP_010093989.1 Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis] EXB55004.1 Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis] Length = 695 Score = 56.6 bits (135), Expect = 9e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 344 FL*PMWFREPDFRPTALDLLQHPFVTGEYQEAQPVYRT*VL 222 FL +EPDFRP A +LLQHPFVT EYQE+ PV+RT VL Sbjct: 315 FLLKCLHKEPDFRPAASELLQHPFVTNEYQESLPVFRTSVL 355