BLASTX nr result
ID: Panax24_contig00008088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00008088 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222775.1 PREDICTED: phosphopantothenate--cysteine ligase 2... 57 1e-06 XP_017222765.1 PREDICTED: phosphopantothenate--cysteine ligase 2... 57 1e-06 XP_017222764.1 PREDICTED: phosphopantothenate--cysteine ligase 2... 57 1e-06 XP_017222912.1 PREDICTED: phosphopantothenate--cysteine ligase 1... 56 2e-06 XP_017222911.1 PREDICTED: phosphopantothenate--cysteine ligase 1... 56 2e-06 >XP_017222775.1 PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X4 [Daucus carota subsp. sativus] Length = 323 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 265 ALTMEITDNSAASLETTYDEIKSFFDSAPQLRDGISVSTKLNEFIGMNS 411 ALT+++ + +A S ET +DEIKSFFDSAP L+DG + KLN F+ NS Sbjct: 62 ALTIDMENKAATSEETAFDEIKSFFDSAPPLKDGDGIVKKLNGFLEKNS 110 >XP_017222765.1 PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X2 [Daucus carota subsp. sativus] Length = 357 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 265 ALTMEITDNSAASLETTYDEIKSFFDSAPQLRDGISVSTKLNEFIGMNS 411 ALT+++ + +A S ET +DEIKSFFDSAP L+DG + KLN F+ NS Sbjct: 29 ALTIDMENKAATSEETAFDEIKSFFDSAPPLKDGDGIVKKLNGFLEKNS 77 >XP_017222764.1 PREDICTED: phosphopantothenate--cysteine ligase 2-like isoform X1 [Daucus carota subsp. sativus] Length = 390 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 265 ALTMEITDNSAASLETTYDEIKSFFDSAPQLRDGISVSTKLNEFIGMNS 411 ALT+++ + +A S ET +DEIKSFFDSAP L+DG + KLN F+ NS Sbjct: 62 ALTIDMENKAATSEETAFDEIKSFFDSAPPLKDGDGIVKKLNGFLEKNS 110 >XP_017222912.1 PREDICTED: phosphopantothenate--cysteine ligase 1-like isoform X2 [Daucus carota subsp. sativus] Length = 361 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/52 (55%), Positives = 33/52 (63%) Frame = +1 Query: 262 TALTMEITDNSAASLETTYDEIKSFFDSAPQLRDGISVSTKLNEFIGMNSSS 417 T L E+ S E YDEIK FFDSAP LRDG +V KL+EF+ NSSS Sbjct: 34 TVLMTEMEKKSGTPQEIAYDEIKDFFDSAPPLRDGNTVCKKLHEFLETNSSS 85 >XP_017222911.1 PREDICTED: phosphopantothenate--cysteine ligase 1-like isoform X1 [Daucus carota subsp. sativus] Length = 364 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/52 (55%), Positives = 33/52 (63%) Frame = +1 Query: 262 TALTMEITDNSAASLETTYDEIKSFFDSAPQLRDGISVSTKLNEFIGMNSSS 417 T L E+ S E YDEIK FFDSAP LRDG +V KL+EF+ NSSS Sbjct: 34 TVLMTEMEKKSGTPQEIAYDEIKDFFDSAPPLRDGNTVCKKLHEFLETNSSS 85