BLASTX nr result
ID: Panax24_contig00007991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00007991 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07453.1 hypothetical protein DCAR_008290 [Daucus carota subsp... 61 6e-10 CDP12984.1 unnamed protein product [Coffea canephora] 57 3e-08 >KZN07453.1 hypothetical protein DCAR_008290 [Daucus carota subsp. sativus] Length = 80 Score = 61.2 bits (147), Expect = 6e-10 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 1 PDKILDSITFEILSSRDEAVLNNTDRTDDFRSKLISISNIQSSDFSVTRCNGNP 162 PDK DS+ FE + ++AV +TD DD RSKLISIS+ QS D + TRCNG+P Sbjct: 27 PDKKFDSVAFENFDNENKAVEISTDEVDDIRSKLISISSKQSPDSNQTRCNGHP 80 >CDP12984.1 unnamed protein product [Coffea canephora] Length = 87 Score = 57.0 bits (136), Expect = 3e-08 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +1 Query: 1 PDKILDSITFEILSSRDEAVLNNTDRTDDFRSKLISISNIQSSDFSVTRCNGN 159 PD IL S+ E L++ + V N+D D FRSKLISIS+++S D + RCNG+ Sbjct: 27 PDTILSSVVVETLNTGHQVVATNSDGADKFRSKLISISDLRSPDIGIIRCNGH 79