BLASTX nr result
ID: Panax24_contig00007855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00007855 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM93027.1 hypothetical protein DCAR_016272 [Daucus carota subsp... 70 4e-11 XP_006492079.1 PREDICTED: protein TSS-like [Citrus sinensis] XP_... 67 5e-11 XP_006495362.1 PREDICTED: protein TSS-like isoform X1 [Citrus si... 67 8e-11 KVI06069.1 Tetratricopeptide-like helical [Cynara cardunculus va... 69 1e-10 XP_017252108.1 PREDICTED: protein TSS [Daucus carota subsp. sati... 69 1e-10 KHN01315.1 Protein KIAA0664-like protein [Glycine soja] 68 1e-10 KRH47421.1 hypothetical protein GLYMA_07G028800 [Glycine max] 68 1e-10 XP_006583118.1 PREDICTED: protein TSS-like [Glycine max] XP_0065... 68 1e-10 GAU33091.1 hypothetical protein TSUD_259420 [Trifolium subterran... 68 2e-10 EYU21673.1 hypothetical protein MIMGU_mgv1a000140mg [Erythranthe... 67 3e-10 XP_012856333.1 PREDICTED: clustered mitochondria protein [Erythr... 67 3e-10 EEF44839.1 eukaryotic translation initiation factor 3 subunit, p... 67 3e-10 XP_019169757.1 PREDICTED: protein TSS [Ipomoea nil] 67 3e-10 KJB66380.1 hypothetical protein B456_010G138100 [Gossypium raimo... 67 4e-10 XP_006427406.1 hypothetical protein CICLE_v10024937mg [Citrus cl... 67 4e-10 XP_006427421.1 hypothetical protein CICLE_v100246922mg, partial ... 67 5e-10 XP_006427397.1 hypothetical protein CICLE_v100246892mg [Citrus c... 67 5e-10 XP_003604358.1 eukaryotic translation initiation factor 3 subuni... 67 5e-10 XP_006427399.1 hypothetical protein CICLE_v100246892mg [Citrus c... 67 5e-10 XP_003604359.1 eukaryotic translation initiation factor 3 subuni... 67 5e-10 >KZM93027.1 hypothetical protein DCAR_016272 [Daucus carota subsp. sativus] Length = 1608 Score = 69.7 bits (169), Expect = 4e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 RY NRALFLLYFTCGLSHPNTAATYINVAMMEE Sbjct: 857 RYVNRALFLLYFTCGLSHPNTAATYINVAMMEE 889 >XP_006492079.1 PREDICTED: protein TSS-like [Citrus sinensis] XP_006495363.1 PREDICTED: protein TSS-like isoform X2 [Citrus sinensis] Length = 166 Score = 66.6 bits (161), Expect = 5e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 22 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 54 >XP_006495362.1 PREDICTED: protein TSS-like isoform X1 [Citrus sinensis] Length = 196 Score = 66.6 bits (161), Expect = 8e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 22 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 54 >KVI06069.1 Tetratricopeptide-like helical [Cynara cardunculus var. scolymus] Length = 1447 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLLYFTCGLSHPNTAATYINVAMMEE Sbjct: 815 KYVNRALFLLYFTCGLSHPNTAATYINVAMMEE 847 >XP_017252108.1 PREDICTED: protein TSS [Daucus carota subsp. sativus] Length = 1735 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLLYFTCGLSHPNTAATYINVAMMEE Sbjct: 984 KYVNRALFLLYFTCGLSHPNTAATYINVAMMEE 1016 >KHN01315.1 Protein KIAA0664-like protein [Glycine soja] Length = 1673 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEEA 328 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEEA Sbjct: 958 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEEA 991 >KRH47421.1 hypothetical protein GLYMA_07G028800 [Glycine max] Length = 1706 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEEA 328 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEEA Sbjct: 991 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEEA 1024 >XP_006583118.1 PREDICTED: protein TSS-like [Glycine max] XP_006583119.1 PREDICTED: protein TSS-like [Glycine max] KRH47422.1 hypothetical protein GLYMA_07G028800 [Glycine max] KRH47423.1 hypothetical protein GLYMA_07G028800 [Glycine max] KRH47424.1 hypothetical protein GLYMA_07G028800 [Glycine max] Length = 1708 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEEA 328 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEEA Sbjct: 993 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEEA 1026 >GAU33091.1 hypothetical protein TSUD_259420 [Trifolium subterraneum] Length = 1557 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 RY NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 888 RYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 920 >EYU21673.1 hypothetical protein MIMGU_mgv1a000140mg [Erythranthe guttata] Length = 1643 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRAL+LLYFTCGLSHPNTAATYINVAMMEE Sbjct: 964 KYVNRALYLLYFTCGLSHPNTAATYINVAMMEE 996 >XP_012856333.1 PREDICTED: clustered mitochondria protein [Erythranthe guttata] Length = 1663 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRAL+LLYFTCGLSHPNTAATYINVAMMEE Sbjct: 964 KYVNRALYLLYFTCGLSHPNTAATYINVAMMEE 996 >EEF44839.1 eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 1454 Score = 67.0 bits (162), Expect = 3e-10 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEEAKERATA 310 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE A Sbjct: 765 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEEGMGNTAA 804 >XP_019169757.1 PREDICTED: protein TSS [Ipomoea nil] Length = 1702 Score = 67.0 bits (162), Expect = 3e-10 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEEAKERA 316 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE A Sbjct: 984 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEEGMGNA 1021 >KJB66380.1 hypothetical protein B456_010G138100 [Gossypium raimondii] Length = 775 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 76 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 108 >XP_006427406.1 hypothetical protein CICLE_v10024937mg [Citrus clementina] ESR40646.1 hypothetical protein CICLE_v10024937mg [Citrus clementina] Length = 775 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 578 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 610 >XP_006427421.1 hypothetical protein CICLE_v100246922mg, partial [Citrus clementina] ESR40661.1 hypothetical protein CICLE_v100246922mg, partial [Citrus clementina] Length = 1103 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 902 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 934 >XP_006427397.1 hypothetical protein CICLE_v100246892mg [Citrus clementina] ESR40637.1 hypothetical protein CICLE_v100246892mg [Citrus clementina] Length = 1115 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 994 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 1026 >XP_003604358.1 eukaryotic translation initiation factor 3 subunit [Medicago truncatula] AES86555.1 eukaryotic translation initiation factor 3 subunit [Medicago truncatula] Length = 1120 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 972 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 1004 >XP_006427399.1 hypothetical protein CICLE_v100246892mg [Citrus clementina] ESR40639.1 hypothetical protein CICLE_v100246892mg [Citrus clementina] Length = 1138 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 994 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 1026 >XP_003604359.1 eukaryotic translation initiation factor 3 subunit [Medicago truncatula] AES86556.1 eukaryotic translation initiation factor 3 subunit [Medicago truncatula] Length = 1158 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 429 RYFNRALFLLYFTCGLSHPNTAATYINVAMMEE 331 +Y NRALFLL+FTCGLSHPNTAATYINVAMMEE Sbjct: 972 KYVNRALFLLHFTCGLSHPNTAATYINVAMMEE 1004