BLASTX nr result
ID: Panax24_contig00007853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00007853 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243605.1 PREDICTED: jmjC domain-containing protein 4 isofo... 57 1e-06 KZM96602.1 hypothetical protein DCAR_016036 [Daucus carota subsp... 57 1e-06 XP_017243604.1 PREDICTED: jmjC domain-containing protein 4 isofo... 57 1e-06 >XP_017243605.1 PREDICTED: jmjC domain-containing protein 4 isoform X2 [Daucus carota subsp. sativus] Length = 450 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 447 KVSYDMKQGGDLILLDFFESAGSCVCTPEDLVSFINYACTKLSV 316 KVSY+++QGGD+ L FFESA S C+PEDL S I+ C K+SV Sbjct: 401 KVSYNLEQGGDVKFLKFFESASSQTCSPEDLASLIDDVCAKISV 444 >KZM96602.1 hypothetical protein DCAR_016036 [Daucus carota subsp. sativus] Length = 473 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 447 KVSYDMKQGGDLILLDFFESAGSCVCTPEDLVSFINYACTKLSV 316 KVSY+++QGGD+ L FFESA S C+PEDL S I+ C K+SV Sbjct: 424 KVSYNLEQGGDVKFLKFFESASSQTCSPEDLASLIDDVCAKISV 467 >XP_017243604.1 PREDICTED: jmjC domain-containing protein 4 isoform X1 [Daucus carota subsp. sativus] Length = 479 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 447 KVSYDMKQGGDLILLDFFESAGSCVCTPEDLVSFINYACTKLSV 316 KVSY+++QGGD+ L FFESA S C+PEDL S I+ C K+SV Sbjct: 430 KVSYNLEQGGDVKFLKFFESASSQTCSPEDLASLIDDVCAKISV 473