BLASTX nr result
ID: Panax24_contig00007490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00007490 (548 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010650726.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 62 2e-12 KZM86644.1 hypothetical protein DCAR_023778 [Daucus carota subsp... 70 1e-11 XP_017216173.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 70 1e-11 XP_008394271.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 54 1e-10 XP_016462735.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 61 1e-10 XP_009780836.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 61 1e-10 XP_008394273.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 54 1e-10 XP_017178833.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 54 1e-10 APA20261.1 BTB and TAZ domain protein 3 [Populus tomentosa] 64 3e-10 OAY22291.1 hypothetical protein MANES_S012900 [Manihot esculenta... 62 4e-10 XP_006380271.1 hypothetical protein POPTR_0007s00880g [Populus t... 64 1e-09 XP_018839366.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 60 2e-09 XP_018839367.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 60 2e-09 XP_008384050.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 55 2e-09 XP_016508389.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 59 3e-09 XP_009358386.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 54 4e-09 XP_010101356.1 BTB/POZ and TAZ domain-containing protein 3 [Moru... 57 4e-09 XP_009366232.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 53 8e-09 XP_011047644.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 61 1e-08 XP_002323915.2 hypothetical protein POPTR_0017s04240g [Populus t... 57 1e-08 >XP_010650726.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] XP_010650727.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] XP_019075766.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] CBI24713.3 unnamed protein product, partial [Vitis vinifera] Length = 407 Score = 62.0 bits (149), Expect(2) = 2e-12 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 192 TSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVL 311 +SVP+ETK TWDKLFK+ Y AD+ IITED IIPAH VL Sbjct: 75 SSVPRETKDTWDKLFKDGYGADIHIITEDGPIIPAHSCVL 114 Score = 37.0 bits (84), Expect(2) = 2e-12 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQS 139 SPDL S P +T +SF+GSFN + L + EV+ + VC + Sbjct: 3 SPDLVSSLPCSTGESFSGSFNIAIEETSPANFLPVLEVSNSSVCNN 48 >KZM86644.1 hypothetical protein DCAR_023778 [Daucus carota subsp. sativus] Length = 458 Score = 70.5 bits (171), Expect(2) = 1e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +3 Query: 168 KTSGRCGLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 K GRC L VPKETK TWD LFK+ YAADV ++ E+EAIIPAHFIVL+ Sbjct: 119 KLPGRC-LNFVPKETKQTWDDLFKQGYAADVCVVAENEAIIPAHFIVLN 166 Score = 25.8 bits (55), Expect(2) = 1e-11 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQS 139 SPD SPW S T +S S + + +E +CQS Sbjct: 52 SPDFDSPWSSLTFESLIKSLDVECEERNTGMGITFREKVTAPLCQS 97 >XP_017216173.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Daucus carota subsp. sativus] XP_017216174.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Daucus carota subsp. sativus] Length = 409 Score = 70.5 bits (171), Expect(2) = 1e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +3 Query: 168 KTSGRCGLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 K GRC L VPKETK TWD LFK+ YAADV ++ E+EAIIPAHFIVL+ Sbjct: 70 KLPGRC-LNFVPKETKQTWDDLFKQGYAADVCVVAENEAIIPAHFIVLN 117 Score = 25.8 bits (55), Expect(2) = 1e-11 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQS 139 SPD SPW S T +S S + + +E +CQS Sbjct: 3 SPDFDSPWSSLTFESLIKSLDVECEERNTGMGITFREKVTAPLCQS 48 >XP_008394271.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] XP_008394272.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] XP_017178831.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] XP_017178832.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Malus domestica] Length = 407 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 29/49 (59%), Positives = 32/49 (65%) Frame = +3 Query: 168 KTSGRCGLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 + S RC VP ET TWDKLFKEAY ADV I TED + IP H VL+ Sbjct: 70 RLSQRC---YVPDETLDTWDKLFKEAYGADVYICTEDGSCIPVHSSVLT 115 Score = 38.9 bits (89), Expect(2) = 1e-10 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSL-ALQEVTGNHVCQSRV 145 SP L SPWPS+T+++F+GSFN D L L++ T + C + Sbjct: 3 SPTLDSPWPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNI 51 >XP_016462735.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462743.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462751.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462755.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] Length = 402 Score = 61.2 bits (147), Expect(2) = 1e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VPKE K TWDKLFKE Y ADV IIT+D + IPAH+ +LS Sbjct: 77 VPKEAKDTWDKLFKEGYGADVHIITDDGSFIPAHYALLS 115 Score = 32.0 bits (71), Expect(2) = 1e-10 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVC 133 SPD+++PW S+ +SF GSF DS+ E + C Sbjct: 3 SPDVHTPWLSSAVESFGGSFKIRIEEEETVDSIEFFEDPSSLAC 46 >XP_009780836.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780837.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780838.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780839.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] Length = 402 Score = 61.2 bits (147), Expect(2) = 1e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VPKE K TWDKLFKE Y ADV IIT+D + IPAH+ +LS Sbjct: 77 VPKEAKDTWDKLFKEGYGADVHIITDDGSFIPAHYALLS 115 Score = 32.0 bits (71), Expect(2) = 1e-10 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVC 133 SPD+++PW S+ +SF GSF DS+ E + C Sbjct: 3 SPDVHTPWLSSAVESFGGSFKIRIEEEETVDSIEFFEDPSSLAC 46 >XP_008394273.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X2 [Malus domestica] Length = 395 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = +3 Query: 168 KTSGRCGLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLSKQ 320 + S RC VP ET TWDKLFKEAY ADV I TED + IP H VL + Sbjct: 70 RLSQRC---YVPDETLDTWDKLFKEAYGADVYICTEDGSCIPVHSSVLQSK 117 Score = 38.9 bits (89), Expect(2) = 1e-10 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSL-ALQEVTGNHVCQSRV 145 SP L SPWPS+T+++F+GSFN D L L++ T + C + Sbjct: 3 SPTLDSPWPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNI 51 >XP_017178833.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X3 [Malus domestica] Length = 385 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 29/49 (59%), Positives = 32/49 (65%) Frame = +3 Query: 168 KTSGRCGLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 + S RC VP ET TWDKLFKEAY ADV I TED + IP H VL+ Sbjct: 70 RLSQRC---YVPDETLDTWDKLFKEAYGADVYICTEDGSCIPVHSSVLT 115 Score = 38.9 bits (89), Expect(2) = 1e-10 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSL-ALQEVTGNHVCQSRV 145 SP L SPWPS+T+++F+GSFN D L L++ T + C + Sbjct: 3 SPTLDSPWPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNI 51 >APA20261.1 BTB and TAZ domain protein 3 [Populus tomentosa] Length = 407 Score = 63.5 bits (153), Expect(2) = 3e-10 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = +3 Query: 162 SSKTSGRC----GLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SKT+ C SVPKETK TWD+LFKEAY +DV IITE + IPAH VLS Sbjct: 61 TSKTTSHCKRISASCSVPKETKDTWDRLFKEAYGSDVYIITESNSCIPAHCNVLS 115 Score = 28.1 bits (61), Expect(2) = 3e-10 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQSR 142 SPD+ SPW +SF G FN + L + E + V +R Sbjct: 3 SPDVDSPWLCAATESFGGCFNAQIEEVKSTNVLNVLEAPTSSVYDTR 49 >OAY22291.1 hypothetical protein MANES_S012900 [Manihot esculenta] OAY22292.1 hypothetical protein MANES_S012900 [Manihot esculenta] OAY22293.1 hypothetical protein MANES_S012900 [Manihot esculenta] Length = 398 Score = 62.4 bits (150), Expect(2) = 4e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 192 TSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SVPKE +TWD+LFKE Y ADV IIT+D+A IPAHF VLS Sbjct: 73 SSVPKEILNTWDRLFKEGYGADVYIITDDKAYIPAHFNVLS 113 Score = 28.9 bits (63), Expect(2) = 4e-10 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQE 112 SPDL+S W S ++S +G FN D L + E Sbjct: 3 SPDLHSSWLSAADESVSGCFNINTEGMNSADVLHVLE 39 >XP_006380271.1 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] XP_006380272.1 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] XP_002309738.2 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] ERP58068.1 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] ERP58069.1 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] EEE90188.2 hypothetical protein POPTR_0007s00880g [Populus trichocarpa] Length = 407 Score = 63.5 bits (153), Expect(2) = 1e-09 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = +3 Query: 162 SSKTSGRC----GLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SKT+ C SVPKETK TWD+LFKEAY +DV IITE + IPAH VLS Sbjct: 61 TSKTTSHCKRISASCSVPKETKDTWDRLFKEAYGSDVYIITESNSYIPAHCNVLS 115 Score = 26.2 bits (56), Expect(2) = 1e-09 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQSR 142 SPD+ SPW ++S G FN + L + E + V +R Sbjct: 3 SPDVDSPWLCAASESLGGCFNTQIEEVKSTNVLNVLEAPTSSVYDTR 49 >XP_018839366.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Juglans regia] Length = 401 Score = 59.7 bits (143), Expect(2) = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 192 TSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SVPKETK TWDKLFKE Y +DV +ITED++ I AH VLS Sbjct: 75 SSVPKETKDTWDKLFKEGYGSDVFVITEDKSHIQAHSCVLS 115 Score = 29.6 bits (65), Expect(2) = 2e-09 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEV 115 +PD SPW S++ +SF GSFN D L + EV Sbjct: 5 NPD--SPWLSSSGESFRGSFNIHLEEDNPADILPVLEV 40 >XP_018839367.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X2 [Juglans regia] Length = 383 Score = 59.7 bits (143), Expect(2) = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 192 TSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SVPKETK TWDKLFKE Y +DV +ITED++ I AH VLS Sbjct: 75 SSVPKETKDTWDKLFKEGYGSDVFVITEDKSHIQAHSCVLS 115 Score = 29.6 bits (65), Expect(2) = 2e-09 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEV 115 +PD SPW S++ +SF GSFN D L + EV Sbjct: 5 NPD--SPWLSSSGESFRGSFNIHLEEDNPADILPVLEV 40 >XP_008384050.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Malus domestica] XP_008384056.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Malus domestica] Length = 407 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VP ET TWDKLFKEAY ADV I T+DE+ IP H VL+ Sbjct: 77 VPNETIDTWDKLFKEAYGADVYICTKDESCIPVHSSVLT 115 Score = 33.9 bits (76), Expect(2) = 2e-09 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQE 112 +PD SPWPS+T+ SF+GSFN D L + E Sbjct: 5 TPD--SPWPSSTHDSFSGSFNIHIEEANPDDILPVLE 39 >XP_016508389.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] Length = 406 Score = 59.3 bits (142), Expect(2) = 3e-09 Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +3 Query: 162 SSKTSGRCGLTSV---PKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 SSK + R L++ PKE K TWDKLFKE Y ADV IITE + IPAH+ +LS Sbjct: 62 SSKATNRRQLSNSDCDPKEIKDTWDKLFKEGYGADVHIITEHGSFIPAHYALLS 115 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVC 133 SPD+ +PW S+ +SF GSF +S+ E + C Sbjct: 3 SPDMRTPWLSSAVESFGGSFKIRIEEEETVESVEFFEDPSSPAC 46 >XP_009358386.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] Length = 407 Score = 54.3 bits (129), Expect(2) = 4e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VP ET TWDKLFKEAY ADV I TED + IP H VL+ Sbjct: 77 VPNETLDTWDKLFKEAYGADVYICTEDGSCIPVHSSVLT 115 Score = 33.9 bits (76), Expect(2) = 4e-09 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSL-ALQEVTGNHVCQSRV 145 SP L SP PS+T+++F+GSFN D L L++ T + C + Sbjct: 3 SPTLDSPCPSSTSETFSGSFNISIEEENPDDILPVLEDPTSSMSCSHNI 51 >XP_010101356.1 BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis] EXB88303.1 BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis] Length = 812 Score = 56.6 bits (135), Expect(2) = 4e-09 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VPKET TWDKLFKE + ADV +ITED+ IP+H +LS Sbjct: 77 VPKETVDTWDKLFKEGHGADVYVITEDDLFIPSHSSILS 115 Score = 31.2 bits (69), Expect(2) = 4e-09 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHV 130 SPDL S WPS++ SF+GS + D L + E + V Sbjct: 3 SPDLDSTWPSSSGYSFSGSLDIRLEEANSADILPVLEAPTSSV 45 >XP_009366232.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] XP_009366233.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] Length = 407 Score = 53.1 bits (126), Expect(2) = 8e-09 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 198 VPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 VP ET TWDKLFKEAY ADV I TED IP H VL+ Sbjct: 77 VPNETIDTWDKLFKEAYGADVYICTEDGLCIPVHSSVLT 115 Score = 33.9 bits (76), Expect(2) = 8e-09 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQE 112 +PD SPWPS+T+ SF+GSFN D L + E Sbjct: 5 TPD--SPWPSSTHDSFSGSFNIHIEEVNPDDILPVLE 39 >XP_011047644.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Populus euphratica] XP_011047645.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Populus euphratica] XP_011047648.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Populus euphratica] XP_011047649.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Populus euphratica] Length = 407 Score = 61.2 bits (147), Expect(2) = 1e-08 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +3 Query: 168 KTSGRC----GLTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 KT+ C SVPKETK TWD+LFKEAY +DV IITE + +PAH VLS Sbjct: 63 KTTSHCKRISASCSVPKETKDTWDRLFKEAYGSDVYIITESNSYVPAHCNVLS 115 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFNXXXXXXXXXDSLALQEVTGNHVCQSR 142 SPD+ S W +SF G FN + L + E + V +R Sbjct: 3 SPDIDSSWLCAATESFGGCFNAQIEEVKSTNVLNVLEAPTSSVYDTR 49 >XP_002323915.2 hypothetical protein POPTR_0017s04240g [Populus trichocarpa] EEF04048.2 hypothetical protein POPTR_0017s04240g [Populus trichocarpa] Length = 407 Score = 56.6 bits (135), Expect(2) = 1e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +3 Query: 162 SSKTSGRCG----LTSVPKETKHTWDKLFKEAYAADVRIITEDEAIIPAHFIVLS 314 +SK + C SVP+E K TWD+LFKEAY DV IIT+ ++ IPAH VLS Sbjct: 61 TSKAANNCKRILETCSVPREIKDTWDRLFKEAYGVDVYIITDSKSYIPAHCNVLS 115 Score = 30.0 bits (66), Expect(2) = 1e-08 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 2 SPDLYSPWPSTTNQSFTGSFN 64 SPD+ SPW N+SF G FN Sbjct: 3 SPDVDSPWLCAANESFGGCFN 23