BLASTX nr result
ID: Panax24_contig00007032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00007032 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010099378.1 Ketol-acid reductoisomerase [Morus notabilis] EXB... 93 2e-21 OAY33944.1 hypothetical protein MANES_13G137600 [Manihot esculenta] 92 2e-20 CBI21968.3 unnamed protein product, partial [Vitis vinifera] 95 2e-20 XP_002280094.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 95 2e-20 XP_019193646.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 95 2e-20 BAD94384.1 ketol-acid reductoisomerase [Arabidopsis thaliana] 94 3e-20 XP_017247410.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 5e-20 KDP31790.1 hypothetical protein JCGZ_12251 [Jatropha curcas] 92 6e-20 XP_011043385.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 6e-20 XP_006377362.1 hypothetical protein POPTR_0011s05250g [Populus t... 94 6e-20 XP_008455269.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 9e-20 XP_010516509.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 9e-20 XP_010504816.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 9e-20 NP_191420.1 ketol-acid reductoisomerase [Arabidopsis thaliana] N... 94 9e-20 XP_010427764.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 94 9e-20 BAH20088.1 AT3G58610 [Arabidopsis thaliana] 94 9e-20 XP_006290799.1 hypothetical protein CARUB_v10016904mg [Capsella ... 94 9e-20 XP_002876470.1 ketol-acid reductoisomerase [Arabidopsis lyrata s... 94 9e-20 XP_004505501.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 93 1e-19 XP_018840362.1 PREDICTED: ketol-acid reductoisomerase, chloropla... 93 1e-19 >XP_010099378.1 Ketol-acid reductoisomerase [Morus notabilis] EXB78103.1 Ketol-acid reductoisomerase [Morus notabilis] Length = 165 Score = 92.8 bits (229), Expect = 2e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 N+DLISNFLSDPVHGA+EVCAQLRPSVDISVP DADFVRPELRQSSN Sbjct: 119 NQDLISNFLSDPVHGAIEVCAQLRPSVDISVPQDADFVRPELRQSSN 165 >OAY33944.1 hypothetical protein MANES_13G137600 [Manihot esculenta] Length = 229 Score = 92.0 bits (227), Expect = 2e-20 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP+VDISVP DADFVRPELRQS+N Sbjct: 183 NRDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSTN 229 >CBI21968.3 unnamed protein product, partial [Vitis vinifera] Length = 524 Score = 95.1 bits (235), Expect = 2e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 478 NRDLISNFLSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 524 >XP_002280094.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Vitis vinifera] CAN69003.1 hypothetical protein VITISV_005408 [Vitis vinifera] Length = 588 Score = 95.1 bits (235), Expect = 2e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 542 NRDLISNFLSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 588 >XP_019193646.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Ipomoea nil] Length = 592 Score = 95.1 bits (235), Expect = 2e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 546 NRDLISNFLSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 592 >BAD94384.1 ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 344 Score = 93.6 bits (231), Expect = 3e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 298 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 344 >XP_017247410.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Daucus carota subsp. sativus] KZM99573.1 hypothetical protein DCAR_013065 [Daucus carota subsp. sativus] Length = 590 Score = 94.4 bits (233), Expect = 5e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 N+DLISNF+SDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN Sbjct: 544 NQDLISNFMSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 590 >KDP31790.1 hypothetical protein JCGZ_12251 [Jatropha curcas] Length = 302 Score = 92.0 bits (227), Expect = 6e-20 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP++DISVP DADFVRPELRQSSN Sbjct: 256 NRDLISNFLSDPVHGAIEVCAQLRPTLDISVPPDADFVRPELRQSSN 302 >XP_011043385.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Populus euphratica] Length = 588 Score = 94.0 bits (232), Expect = 6e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGAVEVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 542 NRDLISNFFSDPVHGAVEVCAQLRPTVDISVPADADFVRPELRQSSN 588 >XP_006377362.1 hypothetical protein POPTR_0011s05250g [Populus trichocarpa] ERP55159.1 hypothetical protein POPTR_0011s05250g [Populus trichocarpa] Length = 588 Score = 94.0 bits (232), Expect = 6e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGAVEVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 542 NRDLISNFFSDPVHGAVEVCAQLRPTVDISVPADADFVRPELRQSSN 588 >XP_008455269.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Cucumis melo] Length = 588 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 N+DLISNFLSDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 542 NQDLISNFLSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 588 >XP_010516509.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Camelina sativa] Length = 590 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 544 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 590 >XP_010504816.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Camelina sativa] Length = 590 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 544 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 590 >NP_191420.1 ketol-acid reductoisomerase [Arabidopsis thaliana] NP_001078309.1 ketol-acid reductoisomerase [Arabidopsis thaliana] NP_001190127.1 ketol-acid reductoisomerase [Arabidopsis thaliana] Q05758.2 RecName: Full=Ketol-acid reductoisomerase, chloroplastic; AltName: Full=Acetohydroxy-acid reductoisomerase; AltName: Full=Alpha-keto-beta-hydroxylacyl reductoisomerase; Flags: Precursor AAG40022.1 AT3g58610 [Arabidopsis thaliana] AAG42917.1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] CAA49506.1 ketol-acid reductoisomerase [Arabidopsis thaliana] CAB68199.1 ketol-acid reductoisomerase [Arabidopsis thaliana] AAL32973.1 AT3g58610/F14P22_200 [Arabidopsis thaliana] AAL38839.1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] AAM20206.1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] AAN31816.1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] AAN33197.1 At3g58610/F14P22_200 [Arabidopsis thaliana] AEE79804.1 ketol-acid reductoisomerase [Arabidopsis thaliana] AEE79805.1 ketol-acid reductoisomerase [Arabidopsis thaliana] AEE79806.1 ketol-acid reductoisomerase [Arabidopsis thaliana] OAP05158.1 hypothetical protein AXX17_AT3G53150 [Arabidopsis thaliana] Length = 591 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 545 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >XP_010427764.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Camelina sativa] Length = 591 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 545 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >BAH20088.1 AT3G58610 [Arabidopsis thaliana] Length = 591 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 545 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >XP_006290799.1 hypothetical protein CARUB_v10016904mg [Capsella rubella] EOA23697.1 hypothetical protein CARUB_v10016904mg [Capsella rubella] Length = 591 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 545 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591 >XP_002876470.1 ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] EFH52729.1 ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] Length = 594 Score = 93.6 bits (231), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF SDPVHGA+EVCAQLRP+VDISVPADADFVRPELRQSSN Sbjct: 548 NRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 594 >XP_004505501.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic [Cicer arietinum] Length = 581 Score = 93.2 bits (230), Expect = 1e-19 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNF+SDPVHGA+EVCA+LRP+VDISVPADADFVRPELRQSSN Sbjct: 535 NRDLISNFMSDPVHGAIEVCAELRPTVDISVPADADFVRPELRQSSN 581 >XP_018840362.1 PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Juglans regia] Length = 590 Score = 93.2 bits (230), Expect = 1e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 24 NRDLISNFLSDPVHGAVEVCAQLRPSVDISVPADADFVRPELRQSSN 164 NRDLISNFLSDPVHGA+EVCAQLRP+VDISVP DADFVRPELRQSSN Sbjct: 544 NRDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQSSN 590