BLASTX nr result
ID: Panax24_contig00006648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00006648 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019182348.1 PREDICTED: ABC transporter F family member 3 [Ipo... 73 1e-12 XP_017226623.1 PREDICTED: ABC transporter F family member 3 isof... 71 4e-12 XP_019259314.1 PREDICTED: ABC transporter F family member 3 [Nic... 71 4e-12 XP_016565502.1 PREDICTED: ABC transporter F family member 3 [Cap... 71 4e-12 XP_016484953.1 PREDICTED: ABC transporter F family member 3-like... 71 4e-12 XP_009758739.1 PREDICTED: ABC transporter F family member 3 [Nic... 71 4e-12 XP_009593823.1 PREDICTED: ABC transporter F family member 3 [Nic... 71 4e-12 KZM82254.1 hypothetical protein DCAR_029862 [Daucus carota subsp... 71 5e-12 XP_002518872.2 PREDICTED: ABC transporter F family member 3 [Ric... 69 2e-11 XP_018835197.1 PREDICTED: ABC transporter F family member 3 [Jug... 69 2e-11 CDP12197.1 unnamed protein product [Coffea canephora] 69 2e-11 KHN09945.1 ABC transporter F family member 3 [Glycine soja] 69 3e-11 NP_001236916.1 ABC transporter-like protein [Glycine max] AAL667... 69 3e-11 KRH17599.1 hypothetical protein GLYMA_13G002500 [Glycine max] KR... 69 3e-11 XP_003555682.1 PREDICTED: ABC transporter F family member 3-like... 69 3e-11 XP_019458529.1 PREDICTED: ABC transporter F family member 3 [Lup... 69 3e-11 XP_010266595.1 PREDICTED: ABC transporter F family member 3 [Nel... 69 3e-11 KHN42235.1 ABC transporter F family member 3 [Glycine soja] 69 3e-11 XP_016204433.1 PREDICTED: ABC transporter F family member 3 [Ara... 68 7e-11 XP_003601462.1 ABC transporter F family-like protein [Medicago t... 68 7e-11 >XP_019182348.1 PREDICTED: ABC transporter F family member 3 [Ipomoea nil] Length = 715 Score = 72.8 bits (177), Expect = 1e-12 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSF+TDMQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 325 LAGLSFSTDMQKRATKTFSGGWRMRIALARALFIEPDMLLLDEPTN 370 >XP_017226623.1 PREDICTED: ABC transporter F family member 3 isoform X1 [Daucus carota subsp. sativus] XP_017226624.1 PREDICTED: ABC transporter F family member 3 isoform X2 [Daucus carota subsp. sativus] Length = 716 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT+DMQKRAT+TFSGGWRMRIALARALFIE LD P N Sbjct: 326 LAGLSFTSDMQKRATRTFSGGWRMRIALARALFIEPDLLLLDEPTN 371 >XP_019259314.1 PREDICTED: ABC transporter F family member 3 [Nicotiana attenuata] OIT07267.1 abc transporter f family member 3 [Nicotiana attenuata] Length = 717 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 ++GLSFTT+MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 327 LSGLSFTTEMQKRATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 372 >XP_016565502.1 PREDICTED: ABC transporter F family member 3 [Capsicum annuum] Length = 717 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 ++GLSFTT+MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 326 LSGLSFTTEMQKRATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 371 >XP_016484953.1 PREDICTED: ABC transporter F family member 3-like [Nicotiana tabacum] Length = 717 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 ++GLSFTT+MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 327 LSGLSFTTEMQKRATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 372 >XP_009758739.1 PREDICTED: ABC transporter F family member 3 [Nicotiana sylvestris] XP_016488726.1 PREDICTED: ABC transporter F family member 3-like [Nicotiana tabacum] Length = 717 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 ++GLSFTT+MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 327 LSGLSFTTEMQKRATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 372 >XP_009593823.1 PREDICTED: ABC transporter F family member 3 [Nicotiana tomentosiformis] Length = 717 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 ++GLSFTT+MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 327 LSGLSFTTEMQKRATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 372 >KZM82254.1 hypothetical protein DCAR_029862 [Daucus carota subsp. sativus] Length = 990 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT+DMQKRAT+TFSGGWRMRIALARALFIE LD P N Sbjct: 600 LAGLSFTSDMQKRATRTFSGGWRMRIALARALFIEPDLLLLDEPTN 645 >XP_002518872.2 PREDICTED: ABC transporter F family member 3 [Ricinus communis] Length = 715 Score = 69.3 bits (168), Expect = 2e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 324 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDMLLLDEPTN 369 >XP_018835197.1 PREDICTED: ABC transporter F family member 3 [Juglans regia] Length = 716 Score = 69.3 bits (168), Expect = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSF++DMQK+ATKTFSGGWRMRIALARALF+E LD P N Sbjct: 325 LAGLSFSSDMQKKATKTFSGGWRMRIALARALFVEPDLLLLDEPTN 370 >CDP12197.1 unnamed protein product [Coffea canephora] Length = 716 Score = 69.3 bits (168), Expect = 2e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSF+++MQKRATKTFSGGWRMRIALARALFIE LD P N Sbjct: 325 LAGLSFSSEMQKRATKTFSGGWRMRIALARALFIEPDILLLDEPTN 370 >KHN09945.1 ABC transporter F family member 3 [Glycine soja] Length = 615 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 224 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDILLLDEPTN 269 >NP_001236916.1 ABC transporter-like protein [Glycine max] AAL66714.1 ABC transporter-like protein [Glycine max] Length = 636 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 321 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDILLLDEPTN 366 >KRH17599.1 hypothetical protein GLYMA_13G002500 [Glycine max] KRH17600.1 hypothetical protein GLYMA_13G002500 [Glycine max] Length = 712 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 321 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDILLLDEPTN 366 >XP_003555682.1 PREDICTED: ABC transporter F family member 3-like [Glycine max] KRG90088.1 hypothetical protein GLYMA_20G066600 [Glycine max] Length = 712 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 321 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDILLLDEPTN 366 >XP_019458529.1 PREDICTED: ABC transporter F family member 3 [Lupinus angustifolius] OIW03025.1 hypothetical protein TanjilG_13662 [Lupinus angustifolius] Length = 713 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALF+E LD P N Sbjct: 323 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFVEPDMLLLDEPTN 368 >XP_010266595.1 PREDICTED: ABC transporter F family member 3 [Nelumbo nucifera] Length = 718 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 326 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDLLLLDEPTN 371 >KHN42235.1 ABC transporter F family member 3 [Glycine soja] Length = 824 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSFT +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 220 LAGLSFTPEMQKKATKTFSGGWRMRIALARALFIEPDILLLDEPTN 265 >XP_016204433.1 PREDICTED: ABC transporter F family member 3 [Arachis ipaensis] Length = 709 Score = 67.8 bits (164), Expect = 7e-11 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSF+ +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 319 LAGLSFSPEMQKKATKTFSGGWRMRIALARALFIEPDMLLLDEPTN 364 >XP_003601462.1 ABC transporter F family-like protein [Medicago truncatula] AES71713.1 ABC transporter F family-like protein [Medicago truncatula] Length = 713 Score = 67.8 bits (164), Expect = 7e-11 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 17 IAGLSFTTDMQKRATKTFSGGWRMRIALARALFIEVYPFHLDLPYN 154 +AGLSF+ +MQK+ATKTFSGGWRMRIALARALFIE LD P N Sbjct: 322 LAGLSFSPEMQKKATKTFSGGWRMRIALARALFIEPDMLLLDEPTN 367