BLASTX nr result
ID: Panax24_contig00006124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00006124 (1015 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07468.1 hypothetical protein DCAR_008305 [Daucus carota subsp... 76 2e-11 XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 ho... 76 2e-11 KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp... 73 2e-10 XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 ho... 73 2e-10 KVH89724.1 RNA helicase UPF1, UPF2-interacting domain-containing... 73 2e-10 XP_012075131.1 PREDICTED: regulator of nonsense transcripts 1 ho... 72 3e-10 XP_007156614.1 hypothetical protein PHAVU_002G003300g [Phaseolus... 72 5e-10 XP_003517385.1 PREDICTED: regulator of nonsense transcripts 1 ho... 72 5e-10 XP_017427296.1 PREDICTED: regulator of nonsense transcripts 1 ho... 72 5e-10 XP_014520729.1 PREDICTED: regulator of nonsense transcripts 1 ho... 72 5e-10 XP_007156615.1 hypothetical protein PHAVU_002G003300g [Phaseolus... 72 5e-10 KOM44874.1 hypothetical protein LR48_Vigan06g018000 [Vigna angul... 72 5e-10 ABK96558.1 unknown [Populus trichocarpa x Populus deltoides] 71 7e-10 XP_006368472.1 RNA helicase family protein [Populus trichocarpa]... 71 1e-09 XP_011018658.1 PREDICTED: regulator of nonsense transcripts 1 ho... 71 1e-09 XP_015872266.1 PREDICTED: regulator of nonsense transcripts 1 ho... 70 1e-09 XP_002279304.2 PREDICTED: regulator of nonsense transcripts 1 ho... 70 2e-09 XP_010664057.1 PREDICTED: regulator of nonsense transcripts 1 ho... 70 2e-09 XP_018848213.1 PREDICTED: regulator of nonsense transcripts 1 ho... 70 2e-09 XP_018848212.1 PREDICTED: regulator of nonsense transcripts 1 ho... 70 2e-09 >KZN07468.1 hypothetical protein DCAR_008305 [Daucus carota subsp. sativus] Length = 1056 Score = 76.3 bits (186), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GSFMPPGPPNGTHKPGLH AGYPMPRVPI PYH Sbjct: 761 GSFMPPGPPNGTHKPGLHPAGYPMPRVPITPYH 793 >XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1254 Score = 76.3 bits (186), Expect = 2e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GSFMPPGPPNGTHKPGLH AGYPMPRVPI PYH Sbjct: 959 GSFMPPGPPNGTHKPGLHPAGYPMPRVPITPYH 991 >KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp. sativus] Length = 1221 Score = 73.2 bits (178), Expect = 2e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GSFMPPGP NGTHKPGLH A YPMPRVPIPPYH Sbjct: 932 GSFMPPGPLNGTHKPGLHPAAYPMPRVPIPPYH 964 >XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1248 Score = 73.2 bits (178), Expect = 2e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GSFMPPGP NGTHKPGLH A YPMPRVPIPPYH Sbjct: 956 GSFMPPGPLNGTHKPGLHPAAYPMPRVPIPPYH 988 >KVH89724.1 RNA helicase UPF1, UPF2-interacting domain-containing protein [Cynara cardunculus var. scolymus] Length = 1236 Score = 72.8 bits (177), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MPPGPPNGTHKP LH A YPMPRVP+PPYH Sbjct: 950 GSYMPPGPPNGTHKPSLHPAAYPMPRVPLPPYH 982 >XP_012075131.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Jatropha curcas] KDP45961.1 hypothetical protein JCGZ_11864 [Jatropha curcas] Length = 1270 Score = 72.4 bits (176), Expect = 3e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MPPGPPNGTHKPG+H G+PMPRVPIPP+H Sbjct: 975 GSYMPPGPPNGTHKPGVHPTGFPMPRVPIPPFH 1007 >XP_007156614.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] ESW28608.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] Length = 1248 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1007 >XP_003517385.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] KRH77259.1 hypothetical protein GLYMA_01G202600 [Glycine max] Length = 1266 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 973 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1005 >XP_017427296.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Vigna angularis] BAU00381.1 hypothetical protein VIGAN_10196800 [Vigna angularis var. angularis] Length = 1268 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1007 >XP_014520729.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Vigna radiata var. radiata] Length = 1268 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1007 >XP_007156615.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] ESW28609.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] Length = 1268 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1007 >KOM44874.1 hypothetical protein LR48_Vigan06g018000 [Vigna angularis] Length = 1294 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 1001 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1033 >ABK96558.1 unknown [Populus trichocarpa x Populus deltoides] Length = 582 Score = 70.9 bits (172), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MPP PPNGTHKPG H AG+PMPRVPIPP+H Sbjct: 288 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFH 320 >XP_006368472.1 RNA helicase family protein [Populus trichocarpa] ERP65041.1 RNA helicase family protein [Populus trichocarpa] Length = 1256 Score = 70.9 bits (172), Expect = 1e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MPP PPNGTHKPG H AG+PMPRVPIPP+H Sbjct: 962 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFH 994 >XP_011018658.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Populus euphratica] Length = 1266 Score = 70.9 bits (172), Expect = 1e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MPP PPNGTHKPG H AG+PMPRVPIPP+H Sbjct: 971 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFH 1003 >XP_015872266.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Ziziphus jujuba] Length = 345 Score = 69.7 bits (169), Expect = 1e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS++PPGPPNGTHKPG+H GYPMPRVPI P+H Sbjct: 49 GSYLPPGPPNGTHKPGVHPGGYPMPRVPITPFH 81 >XP_002279304.2 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X2 [Vitis vinifera] CBI33955.3 unnamed protein product, partial [Vitis vinifera] Length = 1267 Score = 70.1 bits (170), Expect = 2e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MP GPPNGTHKPG+H AG+PMPRVP+PP+H Sbjct: 963 GSYMPSGPPNGTHKPGVHPAGFPMPRVPLPPFH 995 >XP_010664057.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X1 [Vitis vinifera] Length = 1272 Score = 70.1 bits (170), Expect = 2e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 GS+MP GPPNGTHKPG+H AG+PMPRVP+PP+H Sbjct: 963 GSYMPSGPPNGTHKPGVHPAGFPMPRVPLPPFH 995 >XP_018848213.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X3 [Juglans regia] Length = 1284 Score = 70.1 bits (170), Expect = 2e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 G+F+ PGPPNGTHKPG+H AGYPMPRVP+PP+H Sbjct: 986 GTFISPGPPNGTHKPGVHPAGYPMPRVPLPPFH 1018 >XP_018848212.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X2 [Juglans regia] Length = 1285 Score = 70.1 bits (170), Expect = 2e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 101 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 3 G+F+ PGPPNGTHKPG+H AGYPMPRVP+PP+H Sbjct: 987 GTFISPGPPNGTHKPGVHPAGYPMPRVPLPPFH 1019