BLASTX nr result
ID: Panax24_contig00006075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00006075 (546 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH89724.1 RNA helicase UPF1, UPF2-interacting domain-containing... 86 3e-16 KZN07468.1 hypothetical protein DCAR_008305 [Daucus carota subsp... 85 5e-16 XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 ho... 85 6e-16 KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp... 83 4e-15 XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 ho... 83 4e-15 XP_012075131.1 PREDICTED: regulator of nonsense transcripts 1 ho... 80 2e-14 OMO93082.1 hypothetical protein COLO4_17123 [Corchorus olitorius] 80 3e-14 XP_007156614.1 hypothetical protein PHAVU_002G003300g [Phaseolus... 80 4e-14 XP_003517385.1 PREDICTED: regulator of nonsense transcripts 1 ho... 80 4e-14 XP_017427296.1 PREDICTED: regulator of nonsense transcripts 1 ho... 80 4e-14 XP_014520729.1 PREDICTED: regulator of nonsense transcripts 1 ho... 80 4e-14 XP_007156615.1 hypothetical protein PHAVU_002G003300g [Phaseolus... 80 4e-14 KOM44874.1 hypothetical protein LR48_Vigan06g018000 [Vigna angul... 80 4e-14 ABK96558.1 unknown [Populus trichocarpa x Populus deltoides] 79 7e-14 XP_006368472.1 RNA helicase family protein [Populus trichocarpa]... 79 8e-14 XP_011018658.1 PREDICTED: regulator of nonsense transcripts 1 ho... 79 8e-14 XP_015872266.1 PREDICTED: regulator of nonsense transcripts 1 ho... 78 1e-13 XP_002279304.2 PREDICTED: regulator of nonsense transcripts 1 ho... 78 1e-13 XP_010664057.1 PREDICTED: regulator of nonsense transcripts 1 ho... 78 1e-13 XP_002528794.1 PREDICTED: regulator of nonsense transcripts 1 ho... 78 2e-13 >KVH89724.1 RNA helicase UPF1, UPF2-interacting domain-containing protein [Cynara cardunculus var. scolymus] Length = 1236 Score = 85.9 bits (211), Expect = 3e-16 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVPQPYAIP 545 GS+MPPGPPNGTHKP LH A YPMPRV +PPYHG PQPYAIP Sbjct: 950 GSYMPPGPPNGTHKPSLHPAAYPMPRVPLPPYHGGPQPYAIP 991 >KZN07468.1 hypothetical protein DCAR_008305 [Daucus carota subsp. sativus] Length = 1056 Score = 85.1 bits (209), Expect = 5e-16 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYH-GVPQPYAIP 545 GSFMPPGPPNGTHKPGLH AGYPMPRV I PYH G PQPYAIP Sbjct: 761 GSFMPPGPPNGTHKPGLHPAGYPMPRVPITPYHGGPPQPYAIP 803 >XP_017235353.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1254 Score = 85.1 bits (209), Expect = 6e-16 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYH-GVPQPYAIP 545 GSFMPPGPPNGTHKPGLH AGYPMPRV I PYH G PQPYAIP Sbjct: 959 GSFMPPGPPNGTHKPGLHPAGYPMPRVPITPYHGGPPQPYAIP 1001 >KZN04760.1 hypothetical protein DCAR_005597 [Daucus carota subsp. sativus] Length = 1221 Score = 82.8 bits (203), Expect = 4e-15 Identities = 37/43 (86%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGV-PQPYAIP 545 GSFMPPGP NGTHKPGLH A YPMPRV IPPYHG PQPYAIP Sbjct: 932 GSFMPPGPLNGTHKPGLHPAAYPMPRVPIPPYHGAPPQPYAIP 974 >XP_017235298.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Daucus carota subsp. sativus] Length = 1248 Score = 82.8 bits (203), Expect = 4e-15 Identities = 37/43 (86%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGV-PQPYAIP 545 GSFMPPGP NGTHKPGLH A YPMPRV IPPYHG PQPYAIP Sbjct: 956 GSFMPPGPLNGTHKPGLHPAAYPMPRVPIPPYHGAPPQPYAIP 998 >XP_012075131.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Jatropha curcas] KDP45961.1 hypothetical protein JCGZ_11864 [Jatropha curcas] Length = 1270 Score = 80.5 bits (197), Expect = 2e-14 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MPPGPPNGTHKPG+H G+PMPRV IPP+HG P QPYAIP Sbjct: 975 GSYMPPGPPNGTHKPGVHPTGFPMPRVPIPPFHGGPPSQPYAIP 1018 >OMO93082.1 hypothetical protein COLO4_17123 [Corchorus olitorius] Length = 1170 Score = 80.1 bits (196), Expect = 3e-14 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVPQPYAIP 545 G++MPPGPPNGTHKPG+H G+PMPRV +PP+ G PQPYAIP Sbjct: 979 GAYMPPGPPNGTHKPGVHPTGFPMPRVPLPPFPGPPQPYAIP 1020 >XP_007156614.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] ESW28608.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] Length = 1248 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1018 >XP_003517385.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] KRH77259.1 hypothetical protein GLYMA_01G202600 [Glycine max] Length = 1266 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 973 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1016 >XP_017427296.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Vigna angularis] BAU00381.1 hypothetical protein VIGAN_10196800 [Vigna angularis var. angularis] Length = 1268 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1018 >XP_014520729.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Vigna radiata var. radiata] Length = 1268 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1018 >XP_007156615.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] ESW28609.1 hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris] Length = 1268 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 975 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1018 >KOM44874.1 hypothetical protein LR48_Vigan06g018000 [Vigna angularis] Length = 1294 Score = 79.7 bits (195), Expect = 4e-14 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H AGYP+PRV +PP+HG P QPYAIP Sbjct: 1001 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFHGGPQSQPYAIP 1044 >ABK96558.1 unknown [Populus trichocarpa x Populus deltoides] Length = 582 Score = 79.0 bits (193), Expect = 7e-14 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MPP PPNGTHKPG H AG+PMPRV IPP+HG P QPYAIP Sbjct: 288 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFHGDPPSQPYAIP 331 >XP_006368472.1 RNA helicase family protein [Populus trichocarpa] ERP65041.1 RNA helicase family protein [Populus trichocarpa] Length = 1256 Score = 79.0 bits (193), Expect = 8e-14 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MPP PPNGTHKPG H AG+PMPRV IPP+HG P QPYAIP Sbjct: 962 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFHGDPPSQPYAIP 1005 >XP_011018658.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Populus euphratica] Length = 1266 Score = 79.0 bits (193), Expect = 8e-14 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MPP PPNGTHKPG H AG+PMPRV IPP+HG P QPYAIP Sbjct: 971 GSYMPPAPPNGTHKPGAHPAGFPMPRVPIPPFHGDPPSQPYAIP 1014 >XP_015872266.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Ziziphus jujuba] Length = 345 Score = 77.8 bits (190), Expect = 1e-13 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS++PPGPPNGTHKPG+H GYPMPRV I P+HG P QPYAIP Sbjct: 49 GSYLPPGPPNGTHKPGVHPGGYPMPRVPITPFHGGPPSQPYAIP 92 >XP_002279304.2 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X2 [Vitis vinifera] CBI33955.3 unnamed protein product, partial [Vitis vinifera] Length = 1267 Score = 78.2 bits (191), Expect = 1e-13 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MP GPPNGTHKPG+H AG+PMPRV +PP+HG P QPYAIP Sbjct: 963 GSYMPSGPPNGTHKPGVHPAGFPMPRVPLPPFHGGPPSQPYAIP 1006 >XP_010664057.1 PREDICTED: regulator of nonsense transcripts 1 homolog isoform X1 [Vitis vinifera] Length = 1272 Score = 78.2 bits (191), Expect = 1e-13 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MP GPPNGTHKPG+H AG+PMPRV +PP+HG P QPYAIP Sbjct: 963 GSYMPSGPPNGTHKPGVHPAGFPMPRVPLPPFHGGPPSQPYAIP 1006 >XP_002528794.1 PREDICTED: regulator of nonsense transcripts 1 homolog [Ricinus communis] EEF33616.1 nonsense-mediated mRNA decay protein, putative [Ricinus communis] Length = 1280 Score = 77.8 bits (190), Expect = 2e-13 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GSFMPPGPPNGTHKPGLHTAGYPMPRVLIPPYHGVP--QPYAIP 545 GS+MPPGPPNGTHKP +H G+PMPRV +PP+HG P QPYAIP Sbjct: 985 GSYMPPGPPNGTHKPSVHPTGFPMPRVPVPPFHGGPPSQPYAIP 1028