BLASTX nr result
ID: Panax24_contig00005959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005959 (817 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573339.1 PREDICTED: uncharacterized protein LOC105852455 [... 59 3e-06 XP_010093290.1 hypothetical protein L484_006304 [Morus notabilis... 57 1e-05 >XP_012573339.1 PREDICTED: uncharacterized protein LOC105852455 [Cicer arietinum] Length = 630 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 556 PQKMAFCPKEVKRIIXXXXXXXKNAQSHTIRKIIVFIS 669 PQK+AFCPKEVKRII KNAQSHTIRKIIVF S Sbjct: 247 PQKVAFCPKEVKRIIESEALEQKNAQSHTIRKIIVFAS 284 >XP_010093290.1 hypothetical protein L484_006304 [Morus notabilis] EXB53815.1 hypothetical protein L484_006304 [Morus notabilis] Length = 683 Score = 57.4 bits (137), Expect = 1e-05 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = +1 Query: 520 MFELRGS*DGILPQKMAFCPKEVKRIIXXXXXXXKNAQSHTIRKIIVFIS 669 M + S G P K+AFCP+EVKR+I KNAQSHTIRKIIVF S Sbjct: 244 MINYKSSTPGKKPPKVAFCPREVKRVIECEDLQQKNAQSHTIRKIIVFAS 293