BLASTX nr result
ID: Panax24_contig00005924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005924 (470 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254439.1 PREDICTED: probable sphingolipid transporter spin... 64 5e-09 XP_017254438.1 PREDICTED: probable sphingolipid transporter spin... 64 5e-09 CDO97343.1 unnamed protein product [Coffea canephora] 62 2e-08 XP_019243179.1 PREDICTED: probable sphingolipid transporter spin... 59 4e-07 XP_016498617.1 PREDICTED: probable sphingolipid transporter spin... 59 4e-07 XP_009797306.1 PREDICTED: probable sphingolipid transporter spin... 59 4e-07 XP_019170277.1 PREDICTED: probable sphingolipid transporter spin... 58 7e-07 XP_002518297.1 PREDICTED: probable sphingolipid transporter spin... 58 7e-07 XP_019424506.1 PREDICTED: probable sphingolipid transporter spin... 58 7e-07 XP_009632053.1 PREDICTED: probable sphingolipid transporter spin... 57 9e-07 XP_006359365.2 PREDICTED: probable sphingolipid transporter spin... 55 1e-06 XP_015058707.1 PREDICTED: probable sphingolipid transporter spin... 57 2e-06 XP_007199790.1 hypothetical protein PRUPE_ppa004501mg [Prunus pe... 57 2e-06 XP_003528407.1 PREDICTED: probable sphingolipid transporter spin... 57 2e-06 ONH90853.1 hypothetical protein PRUPE_8G077700 [Prunus persica] 57 2e-06 KHN46226.1 Putative sphingolipid transporter spinster like 2 [Gl... 57 2e-06 XP_003532584.1 PREDICTED: probable sphingolipid transporter spin... 57 2e-06 XP_002313948.2 transporter-related family protein [Populus trich... 56 2e-06 XP_006379149.1 hypothetical protein POPTR_0009s08460g [Populus t... 56 2e-06 XP_017223844.1 PREDICTED: probable sphingolipid transporter spin... 56 3e-06 >XP_017254439.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 isoform X2 [Daucus carota subsp. sativus] Length = 525 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 SAIWFIGIFL+SVDRF+EDSEH ITNDR NT PLL Sbjct: 480 SAIWFIGIFLESVDRFDEDSEHTDITNDRLNTTPLL 515 >XP_017254438.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 isoform X1 [Daucus carota subsp. sativus] KZM90746.1 hypothetical protein DCAR_021889 [Daucus carota subsp. sativus] Length = 528 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 SAIWFIGIFL+SVDRF+EDSEH ITNDR NT PLL Sbjct: 483 SAIWFIGIFLESVDRFDEDSEHTDITNDRLNTTPLL 518 >CDO97343.1 unnamed protein product [Coffea canephora] Length = 543 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 SAIWFIGIFL SVDRFNED++HPV DR+NT PLL Sbjct: 494 SAIWFIGIFLRSVDRFNEDTQHPVTAADRANTAPLL 529 >XP_019243179.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Nicotiana attenuata] OIT04453.1 putative sphingolipid transporter spinster -like 2 [Nicotiana attenuata] Length = 534 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDR+NE++EH V DRSNTIPLL Sbjct: 487 SGIWFIGIFLHSVDRYNEENEHQVSIADRSNTIPLL 522 >XP_016498617.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Nicotiana tabacum] Length = 534 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDR+NE++EH V DRSNTIPLL Sbjct: 487 SGIWFIGIFLHSVDRYNEENEHQVSIADRSNTIPLL 522 >XP_009797306.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Nicotiana sylvestris] Length = 534 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDR+NE++EH V DRSNTIPLL Sbjct: 487 SGIWFIGIFLHSVDRYNEENEHQVSIADRSNTIPLL 522 >XP_019170277.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Ipomoea nil] Length = 500 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDRFNEDSEH + DRS+T PLL Sbjct: 457 SGIWFIGIFLHSVDRFNEDSEHSIPIPDRSSTTPLL 492 >XP_002518297.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Ricinus communis] EEF44057.1 transporter, putative [Ricinus communis] Length = 541 Score = 57.8 bits (138), Expect = 7e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 7 IWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 IWFIGIFL SVD+FNE+SEH V DRSNT PLL Sbjct: 494 IWFIGIFLKSVDKFNEESEHQVAVTDRSNTTPLL 527 >XP_019424506.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Lupinus angustifolius] Length = 543 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 + +WFIGIFL+SVDRFNEDSEH V T +R++T+PLL Sbjct: 492 AGLWFIGIFLNSVDRFNEDSEHEVSTVERTSTLPLL 527 >XP_009632053.1 PREDICTED: probable sphingolipid transporter spinster homolog 2, partial [Nicotiana tomentosiformis] XP_016500875.1 PREDICTED: probable sphingolipid transporter spinster homolog 2, partial [Nicotiana tabacum] Length = 356 Score = 57.4 bits (137), Expect = 9e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 + IWFIGIFL SVDR+NE++EH V DRSNTIPLL Sbjct: 309 AGIWFIGIFLHSVDRYNEENEHQVSIADRSNTIPLL 344 >XP_006359365.2 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Solanum tuberosum] Length = 157 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDRFNE+++ V DRSNTIPLL Sbjct: 112 SGIWFIGIFLHSVDRFNEENDLQVSVTDRSNTIPLL 147 >XP_015058707.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Solanum pennellii] Length = 493 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 S IWFIGIFL SVDRFNE++E V DRSNTIPLL Sbjct: 451 SGIWFIGIFLHSVDRFNEENELQVSVTDRSNTIPLL 486 >XP_007199790.1 hypothetical protein PRUPE_ppa004501mg [Prunus persica] Length = 506 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 + IWFIGIFL SVDRFNE+SE+ + T +RSNT PLL Sbjct: 457 AGIWFIGIFLHSVDRFNEESENQITTTERSNTTPLL 492 >XP_003528407.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Glycine max] XP_006583780.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Glycine max] KRH49871.1 hypothetical protein GLYMA_07G184900 [Glycine max] Length = 530 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 +AIWFIGIFL SVDRFNEDSEH V + +R++T PLL Sbjct: 479 AAIWFIGIFLPSVDRFNEDSEHEVSSVERTSTAPLL 514 >ONH90853.1 hypothetical protein PRUPE_8G077700 [Prunus persica] Length = 533 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 + IWFIGIFL SVDRFNE+SE+ + T +RSNT PLL Sbjct: 484 AGIWFIGIFLHSVDRFNEESENQITTTERSNTTPLL 519 >KHN46226.1 Putative sphingolipid transporter spinster like 2 [Glycine soja] Length = 537 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 +AIWFIGIFL SVDRFNEDSEH V + +R++T PLL Sbjct: 486 AAIWFIGIFLPSVDRFNEDSEHEVSSVERTSTAPLL 521 >XP_003532584.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 [Glycine max] KRH42027.1 hypothetical protein GLYMA_08G064500 [Glycine max] Length = 537 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 +AIWFIGIFL SVDRFNEDSEH V + +R++T PLL Sbjct: 486 AAIWFIGIFLPSVDRFNEDSEHEVSSVERTSTAPLL 521 >XP_002313948.2 transporter-related family protein [Populus trichocarpa] EEE87903.2 transporter-related family protein [Populus trichocarpa] Length = 482 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHP-VITNDRSNTIPLL 108 + IWFIGIFL VDRF+E+SEHP V T DRSNT+PLL Sbjct: 432 AVIWFIGIFLHGVDRFDEESEHPQVTTADRSNTMPLL 468 >XP_006379149.1 hypothetical protein POPTR_0009s08460g [Populus trichocarpa] ERP56946.1 hypothetical protein POPTR_0009s08460g [Populus trichocarpa] Length = 504 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHP-VITNDRSNTIPLL 108 + IWFIGIFL VDRF+E+SEHP V T DRSNT+PLL Sbjct: 454 AVIWFIGIFLHGVDRFDEESEHPQVTTADRSNTMPLL 490 >XP_017223844.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 isoform X2 [Daucus carota subsp. sativus] Length = 502 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSNTIPLL 108 SAIWFIGIFL SVDRFNEDSEH V + S++IPLL Sbjct: 453 SAIWFIGIFLHSVDRFNEDSEHSVNGSGASSSIPLL 488