BLASTX nr result
ID: Panax24_contig00005923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005923 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254439.1 PREDICTED: probable sphingolipid transporter spin... 57 2e-06 XP_017254438.1 PREDICTED: probable sphingolipid transporter spin... 57 2e-06 CDO97343.1 unnamed protein product [Coffea canephora] 55 9e-06 >XP_017254439.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 isoform X2 [Daucus carota subsp. sativus] Length = 525 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSN 93 SAIWFIGIFL+SVDRF+EDSEH ITNDR N Sbjct: 480 SAIWFIGIFLESVDRFDEDSEHTDITNDRLN 510 >XP_017254438.1 PREDICTED: probable sphingolipid transporter spinster homolog 2 isoform X1 [Daucus carota subsp. sativus] KZM90746.1 hypothetical protein DCAR_021889 [Daucus carota subsp. sativus] Length = 528 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSN 93 SAIWFIGIFL+SVDRF+EDSEH ITNDR N Sbjct: 483 SAIWFIGIFLESVDRFDEDSEHTDITNDRLN 513 >CDO97343.1 unnamed protein product [Coffea canephora] Length = 543 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 SAIWFIGIFLDSVDRFNEDSEHPVITNDRSN 93 SAIWFIGIFL SVDRFNED++HPV DR+N Sbjct: 494 SAIWFIGIFLRSVDRFNEDTQHPVTAADRAN 524