BLASTX nr result
ID: Panax24_contig00005552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005552 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH96019.1 26S proteasome regulatory subunit, C-terminal [Cynara... 99 2e-21 CDP19574.1 unnamed protein product [Coffea canephora] 97 1e-20 OMO92732.1 hypothetical protein COLO4_17361 [Corchorus olitorius] 96 2e-20 BAA02696.1 21D7 antigen [Daucus carota] 96 2e-20 XP_017258752.1 PREDICTED: probable 26S proteasome non-ATPase reg... 96 2e-20 Q06364.2 RecName: Full=Probable 26S proteasome non-ATPase regula... 96 2e-20 XP_015893145.1 PREDICTED: probable 26S proteasome non-ATPase reg... 95 3e-20 XP_019165989.1 PREDICTED: probable 26S proteasome non-ATPase reg... 96 3e-20 XP_019230774.1 PREDICTED: probable 26S proteasome non-ATPase reg... 96 3e-20 XP_010107643.1 putative 26S proteasome non-ATPase regulatory sub... 95 4e-20 OMO74540.1 hypothetical protein CCACVL1_16626 [Corchorus capsula... 95 7e-20 XP_016441825.1 PREDICTED: probable 26S proteasome non-ATPase reg... 94 8e-20 NP_001311877.1 probable 26S proteasome non-ATPase regulatory sub... 94 8e-20 XP_009773689.1 PREDICTED: probable 26S proteasome non-ATPase reg... 94 8e-20 KVI04059.1 26S proteasome regulatory subunit, C-terminal [Cynara... 94 1e-19 XP_010266868.1 PREDICTED: probable 26S proteasome non-ATPase reg... 93 2e-19 XP_016490139.1 PREDICTED: probable 26S proteasome non-ATPase reg... 93 3e-19 XP_009623855.1 PREDICTED: probable 26S proteasome non-ATPase reg... 93 3e-19 XP_009628272.1 PREDICTED: probable 26S proteasome non-ATPase reg... 92 5e-19 XP_019250770.1 PREDICTED: probable 26S proteasome non-ATPase reg... 92 5e-19 >KVH96019.1 26S proteasome regulatory subunit, C-terminal [Cynara cardunculus var. scolymus] Length = 488 Score = 98.6 bits (244), Expect = 2e-21 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IA+LIEAGAYAREVRRILRAVRLTIALR+KLK+SV+S FL+F L PGSE H+RLSSYLPK Sbjct: 33 IAALIEAGAYAREVRRILRAVRLTIALRRKLKASVVSSFLNFALAPGSETHTRLSSYLPK 92 >CDP19574.1 unnamed protein product [Coffea canephora] Length = 487 Score = 96.7 bits (239), Expect = 1e-20 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI+RAVRLTIALRKKLK+SVIS FL+ L PGSE+HSRLSSY+PK Sbjct: 31 IASLIETGAYAREVRRIVRAVRLTIALRKKLKASVISAFLTHTLTPGSEVHSRLSSYIPK 90 >OMO92732.1 hypothetical protein COLO4_17361 [Corchorus olitorius] Length = 484 Score = 95.9 bits (237), Expect = 2e-20 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRILRAVRLT+ALRKKLK SV+S F++F L PGSE H+RLSSYLPK Sbjct: 31 IASLIETGAYAREVRRILRAVRLTMALRKKLKPSVLSAFINFALTPGSEAHTRLSSYLPK 90 >BAA02696.1 21D7 antigen [Daucus carota] Length = 488 Score = 95.9 bits (237), Expect = 2e-20 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE+GAYAREVRRILRAVRLTIALRKKL +SV++ FL+F L+PGSE+H+RL+SYLPK Sbjct: 33 IASLIESGAYAREVRRILRAVRLTIALRKKLNASVVNAFLNFSLVPGSEVHARLASYLPK 92 >XP_017258752.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Daucus carota subsp. sativus] KZM89821.1 hypothetical protein DCAR_022816 [Daucus carota subsp. sativus] Length = 489 Score = 95.9 bits (237), Expect = 2e-20 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE+GAYAREVRRILRAVRLTIALRKKL +SV++ FL+F L+PGSE+H+RL+SYLPK Sbjct: 33 IASLIESGAYAREVRRILRAVRLTIALRKKLNASVVNAFLNFSLVPGSEVHARLASYLPK 92 >Q06364.2 RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 3; Short=26S proteasome subunit S3; AltName: Full=26S proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 21D7 Length = 489 Score = 95.9 bits (237), Expect = 2e-20 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE+GAYAREVRRILRAVRLTIALRKKL +SV++ FL+F L+PGSE+H+RL+SYLPK Sbjct: 33 IASLIESGAYAREVRRILRAVRLTIALRKKLNASVVNAFLNFSLVPGSEVHARLASYLPK 92 >XP_015893145.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Ziziphus jujuba] Length = 374 Score = 94.7 bits (234), Expect = 3e-20 Identities = 47/60 (78%), Positives = 55/60 (91%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI+R VRLT+ALR+KLK+SV+S FL+F L PGS++HSRLSSYLPK Sbjct: 31 IASLIETGAYAREVRRIVRVVRLTMALRRKLKASVLSSFLNFALAPGSDVHSRLSSYLPK 90 >XP_019165989.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Ipomoea nil] Length = 488 Score = 95.5 bits (236), Expect = 3e-20 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S ++ FL+F+L PGSE+HSRLSSYLPK Sbjct: 32 IASLIETGAYAREVRRIARAVRLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPK 91 >XP_019230774.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana attenuata] OIT29195.1 putative 26s proteasome non-atpase regulatory subunit 3 [Nicotiana attenuata] Length = 488 Score = 95.5 bits (236), Expect = 3e-20 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S +S FL+FVL+PGSE+HSRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNFVLVPGSEVHSRLSSFLPK 91 >XP_010107643.1 putative 26S proteasome non-ATPase regulatory subunit 3 [Morus notabilis] EXC16554.1 putative 26S proteasome non-ATPase regulatory subunit 3 [Morus notabilis] Length = 487 Score = 95.1 bits (235), Expect = 4e-20 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IA+LIE GA+ REVRRILRAVRLT+ALR+KLKSSV+S FL+F L PGSELH+RLSSYLPK Sbjct: 31 IAALIETGAFGREVRRILRAVRLTMALRRKLKSSVLSAFLNFALAPGSELHARLSSYLPK 90 >OMO74540.1 hypothetical protein CCACVL1_16626 [Corchorus capsularis] Length = 874 Score = 94.7 bits (234), Expect = 7e-20 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRILRAVRLT+ALR+KLK SV+S F++F L PGSE H+RLSSYLPK Sbjct: 421 IASLIETGAYAREVRRILRAVRLTMALRRKLKPSVLSAFINFALTPGSEAHTRLSSYLPK 480 >XP_016441825.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana tabacum] Length = 488 Score = 94.4 bits (233), Expect = 8e-20 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S +S FL++VL+PGSE+HSRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVHSRLSSFLPK 91 >NP_001311877.1 probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana tabacum] P93768.1 RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 3; Short=26S proteasome subunit S3; AltName: Full=26S proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 21D7 BAA19252.1 21D7 [Nicotiana tabacum] Length = 488 Score = 94.4 bits (233), Expect = 8e-20 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S +S FL++VL+PGSE+HSRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVHSRLSSFLPK 91 >XP_009773689.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 isoform X1 [Nicotiana sylvestris] Length = 488 Score = 94.4 bits (233), Expect = 8e-20 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S +S FL++VL+PGSE+HSRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVHSRLSSFLPK 91 >KVI04059.1 26S proteasome regulatory subunit, C-terminal [Cynara cardunculus var. scolymus] Length = 455 Score = 93.6 bits (231), Expect = 1e-19 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IA+LIE GA+AREVRRILRA+RLTIALR+KLK+S IS FL+F L PGSE HSRL+SYLPK Sbjct: 34 IAALIETGAHAREVRRILRAIRLTIALRRKLKASAISSFLNFALAPGSEAHSRLASYLPK 93 >XP_010266868.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nelumbo nucifera] XP_010266869.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nelumbo nucifera] Length = 488 Score = 93.2 bits (230), Expect = 2e-19 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI+RAVRLTIALR+KLK+ V+S FL+F L PGSE H RLSSYLPK Sbjct: 31 IASLIETGAYAREVRRIVRAVRLTIALRRKLKAPVLSAFLNFALAPGSEAHIRLSSYLPK 90 >XP_016490139.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana tabacum] Length = 491 Score = 92.8 bits (229), Expect = 3e-19 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLP 261 IASLIE+GAYAREVRRI RAVRLT+ALRKKLK+SV+S FL++ L+P SE+HSRLSSYLP Sbjct: 35 IASLIESGAYAREVRRIARAVRLTMALRKKLKASVLSAFLNYALVPRSEMHSRLSSYLP 93 >XP_009623855.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana tomentosiformis] Length = 491 Score = 92.8 bits (229), Expect = 3e-19 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLP 261 IASLIE+GAYAREVRRI RAVRLT+ALRKKLK+SV+S FL++ L+P SE+HSRLSSYLP Sbjct: 35 IASLIESGAYAREVRRIARAVRLTMALRKKLKASVLSAFLNYALVPRSEMHSRLSSYLP 93 >XP_009628272.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 isoform X1 [Nicotiana tomentosiformis] XP_016492792.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana tabacum] Length = 488 Score = 92.0 bits (227), Expect = 5e-19 Identities = 47/60 (78%), Positives = 56/60 (93%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLPK 258 IASLIE GAYAREVRRI RAVRLT+ALRKKLK+S +S FL++VL+PGSE++SRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVYSRLSSFLPK 91 >XP_019250770.1 PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Nicotiana attenuata] OIT01426.1 putative 26s proteasome non-atpase regulatory subunit 3 [Nicotiana attenuata] Length = 491 Score = 92.0 bits (227), Expect = 5e-19 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -3 Query: 437 IASLIEAGAYAREVRRILRAVRLTIALRKKLKSSVISHFLSFVLLPGSELHSRLSSYLP 261 IASLIE+GAYAREVRRI RAVRLT+ALRKKLK SV+S FL++ L+P SE+HSRLSSYLP Sbjct: 35 IASLIESGAYAREVRRIARAVRLTMALRKKLKGSVLSAFLNYALVPRSEVHSRLSSYLP 93