BLASTX nr result
ID: Panax24_contig00005313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005313 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO52598.1 hypothetical protein COLO4_37081 [Corchorus olitorius] 52 6e-06 >OMO52598.1 hypothetical protein COLO4_37081 [Corchorus olitorius] Length = 74 Score = 51.6 bits (122), Expect = 6e-06 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +3 Query: 168 GENLG*KAPCFLPSKPKYIVYYIKILMTCHASAPVMAKAVSHHNRI 305 GEN G K PC LPSK K V +IK+ +TCHASAPVMAKA +RI Sbjct: 18 GENPG-KFPCELPSKHKKDVDFIKLWVTCHASAPVMAKAEMDIHRI 62