BLASTX nr result
ID: Panax24_contig00005178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00005178 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242519.1 PREDICTED: glucose-6-phosphate isomerase 1, chlor... 55 4e-06 >XP_017242519.1 PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Daucus carota subsp. sativus] KZN00817.1 hypothetical protein DCAR_009571 [Daucus carota subsp. sativus] Length = 613 Score = 55.1 bits (131), Expect = 4e-06 Identities = 43/82 (52%), Positives = 48/82 (58%), Gaps = 2/82 (2%) Frame = +1 Query: 190 ASISGLCSS--PLKKFIPKTSPNTSQIPLRKESIPFLNRSNPVSFNQSSIFSAQSVAREV 363 +SISGL SS PLK + P SQ PL K SI F + Q+ AQSVAREV Sbjct: 3 SSISGLSSSLNPLKS----SHPTPSQFPLTKHSISFRS--------QTHSSKAQSVAREV 50 Query: 364 PASLSKVNAGVPKSKAAGLEED 429 PASLSKVN V KS GLE+D Sbjct: 51 PASLSKVN--VLKSSDLGLEKD 70