BLASTX nr result
ID: Panax24_contig00004983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00004983 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231688.1 PREDICTED: nuclear pore complex protein NUP50A-li... 60 7e-08 >XP_017231688.1 PREDICTED: nuclear pore complex protein NUP50A-like [Daucus carota subsp. sativus] XP_017231689.1 PREDICTED: nuclear pore complex protein NUP50A-like [Daucus carota subsp. sativus] Length = 427 Score = 60.1 bits (144), Expect = 7e-08 Identities = 37/72 (51%), Positives = 41/72 (56%) Frame = -2 Query: 218 SSNPFAGICLVPPTNFYXXXXXXXXXXXSRKSVSKEVEGKNGMNMETEKRKDENDKKPES 39 S + FAGI LVPPT+ S KSVS +V K G+N ETEK KDEN KK ES Sbjct: 45 SDDVFAGIRLVPPTDLSAAPVAVTSADQSVKSVSDDVGEKIGLNQETEKIKDENGKKSES 104 Query: 38 KVDEAGIESTAE 3 KV G E T E Sbjct: 105 KVGGEGTELTVE 116