BLASTX nr result
ID: Panax24_contig00004376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00004376 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252793.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 60 5e-08 KZV27385.1 magnesium-protoporphyrin IX monomethyl ester [Dorcoce... 59 2e-07 XP_007202260.1 hypothetical protein PRUPE_ppa007723mg [Prunus pe... 57 4e-07 AAO89565.2 ZIP [Nicotiana tabacum] 57 4e-07 XP_019264553.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 57 4e-07 XP_009777441.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 57 4e-07 XP_009592266.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 57 4e-07 ONH94563.1 hypothetical protein PRUPE_7G022500 [Prunus persica] 57 4e-07 XP_008240606.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 57 4e-07 CDP14343.1 unnamed protein product [Coffea canephora] 57 8e-07 XP_011079232.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 1e-06 XP_017248509.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 1e-06 XP_018500897.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 1e-06 XP_009347203.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 1e-06 XP_018500896.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 1e-06 NP_001332768.1 putative magnesium-protoporphyrin monomethyl este... 56 2e-06 XP_015055524.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 2e-06 XP_006364756.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 2e-06 XP_011041322.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 2e-06 XP_006364755.1 PREDICTED: magnesium-protoporphyrin IX monomethyl... 56 2e-06 >XP_017252793.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like [Daucus carota subsp. sativus] KZM93699.1 hypothetical protein DCAR_016944 [Daucus carota subsp. sativus] Length = 403 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPI+SGSVDLAEFETQLVY Sbjct: 373 ALASELLAAYLMKPIDSGSVDLAEFETQLVY 403 >KZV27385.1 magnesium-protoporphyrin IX monomethyl ester [Dorcoceras hygrometricum] Length = 407 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKP+ESGSVDLAEFE QLVY Sbjct: 377 ALASELLAAYLMKPVESGSVDLAEFEPQLVY 407 >XP_007202260.1 hypothetical protein PRUPE_ppa007723mg [Prunus persica] Length = 358 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD AEFETQLVY Sbjct: 328 ALASELLAAYLMPPIESGSVDFAEFETQLVY 358 >AAO89565.2 ZIP [Nicotiana tabacum] Length = 371 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QLVY Sbjct: 341 ALASELLAAYLMKPIESGSVDFAEFEPQLVY 371 >XP_019264553.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Nicotiana attenuata] OIT36346.1 magnesium-protoporphyrin ix monomethyl ester [oxidative] cyclase, chloroplastic [Nicotiana attenuata] Length = 404 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QLVY Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLVY 404 >XP_009777441.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Nicotiana sylvestris] XP_016463816.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like [Nicotiana tabacum] Length = 404 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QLVY Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLVY 404 >XP_009592266.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Nicotiana tomentosiformis] XP_016453643.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Nicotiana tabacum] Length = 404 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QLVY Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLVY 404 >ONH94563.1 hypothetical protein PRUPE_7G022500 [Prunus persica] Length = 417 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD AEFETQLVY Sbjct: 387 ALASELLAAYLMPPIESGSVDFAEFETQLVY 417 >XP_008240606.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Prunus mume] Length = 417 Score = 57.4 bits (137), Expect = 4e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD AEFETQLVY Sbjct: 387 ALASELLAAYLMPPIESGSVDFAEFETQLVY 417 >CDP14343.1 unnamed protein product [Coffea canephora] Length = 426 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLA YLMKPIESGSVD+AEFE QLVY Sbjct: 396 ALASELLATYLMKPIESGSVDIAEFEPQLVY 426 >XP_011079232.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Sesamum indicum] Length = 401 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD A+FE QLVY Sbjct: 371 ALASELLAAYLMKPIESGSVDFADFEPQLVY 401 >XP_017248509.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like [Daucus carota subsp. sativus] KZM99125.1 hypothetical protein DCAR_013513 [Daucus carota subsp. sativus] Length = 402 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPI+SGSVD+AEF+ QLVY Sbjct: 372 ALASELLAAYLMKPIDSGSVDIAEFDAQLVY 402 >XP_018500897.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 409 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD A+FETQLVY Sbjct: 379 ALASELLAAYLMPPIESGSVDFADFETQLVY 409 >XP_009347203.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 409 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD A+FETQLVY Sbjct: 379 ALASELLAAYLMPPIESGSVDFADFETQLVY 409 >XP_018500896.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Pyrus x bretschneideri] Length = 409 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD A+FETQLVY Sbjct: 379 ALASELLAAYLMPPIESGSVDFADFETQLVY 409 >NP_001332768.1 putative magnesium-protoporphyrin monomethyl ester cyclase [Solanum lycopersicum] Length = 404 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QL Y Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLTY 404 >XP_015055524.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic [Solanum pennellii] Length = 404 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QL Y Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLTY 404 >XP_006364756.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic isoform X2 [Solanum tuberosum] Length = 404 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QL Y Sbjct: 374 ALASELLAAYLMKPIESGSVDFAEFEPQLTY 404 >XP_011041322.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like isoform X1 [Populus euphratica] XP_011041323.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic-like isoform X2 [Populus euphratica] Length = 405 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLM PIESGSVD AEFE+QLVY Sbjct: 375 ALASELLAAYLMPPIESGSVDFAEFESQLVY 405 >XP_006364755.1 PREDICTED: magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic isoform X1 [Solanum tuberosum] Length = 444 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 391 ALASELLAAYLMKPIESGSVDLAEFETQLVY 299 ALASELLAAYLMKPIESGSVD AEFE QL Y Sbjct: 414 ALASELLAAYLMKPIESGSVDFAEFEPQLTY 444