BLASTX nr result
ID: Panax24_contig00004164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00004164 (651 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI37753.3 unnamed protein product, partial [Vitis vinifera] 84 2e-17 XP_018841547.1 PREDICTED: ubiquitin domain-containing protein DS... 89 4e-17 EOX97451.1 Ubiquitin family protein isoform 1 [Theobroma cacao] 89 6e-17 XP_007199777.1 hypothetical protein PRUPE_ppa003711mg [Prunus pe... 89 8e-17 XP_008235954.1 PREDICTED: ubiquitin domain-containing protein DS... 89 8e-17 XP_008382427.1 PREDICTED: ubiquitin domain-containing protein DS... 87 2e-16 XP_009345918.1 PREDICTED: ubiquitin domain-containing protein DS... 87 2e-16 EOX97452.1 Ubiquitin family protein isoform 2 [Theobroma cacao] 87 2e-16 EOX97453.1 Ubiquitin family protein isoform 3 [Theobroma cacao] 87 2e-16 XP_018841544.1 PREDICTED: ubiquitin domain-containing protein DS... 87 3e-16 XP_017971366.1 PREDICTED: ubiquitin domain-containing protein DS... 87 3e-16 XP_017971365.1 PREDICTED: ubiquitin domain-containing protein DS... 87 3e-16 XP_017971363.1 PREDICTED: ubiquitin domain-containing protein DS... 87 3e-16 XP_012833787.1 PREDICTED: ubiquitin domain-containing protein DS... 86 5e-16 XP_012833786.1 PREDICTED: ubiquitin domain-containing protein DS... 86 5e-16 XP_010111710.1 hypothetical protein L484_006581 [Morus notabilis... 86 5e-16 OMO92019.1 hypothetical protein COLO4_17934 [Corchorus olitorius] 86 5e-16 XP_004153821.1 PREDICTED: ubiquitin domain-containing protein DS... 86 7e-16 XP_008447852.1 PREDICTED: ubiquitin domain-containing protein DS... 86 7e-16 XP_004153820.1 PREDICTED: ubiquitin domain-containing protein DS... 86 7e-16 >CBI37753.3 unnamed protein product, partial [Vitis vinifera] Length = 101 Score = 83.6 bits (205), Expect = 2e-17 Identities = 43/62 (69%), Positives = 49/62 (79%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSVR+ L STV FK +LAQNCD +DQQRLIYKGRILKDDQTL Sbjct: 19 VNIRCSNGSKFSVRTCLESTVGAFKALLAQNCDVP-----SDQQRLIYKGRILKDDQTLE 73 Query: 467 SW 462 S+ Sbjct: 74 SY 75 >XP_018841547.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like [Juglans regia] Length = 559 Score = 89.4 bits (220), Expect = 4e-17 Identities = 46/63 (73%), Positives = 52/63 (82%) Frame = -2 Query: 650 PINVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTL 471 PIN+RCSNGSKF+VR++L STV+ FK VLAQNC D ADQQRLIYKGRILKDDQTL Sbjct: 23 PINIRCSNGSKFAVRTSLQSTVSAFKAVLAQNC-----DVLADQQRLIYKGRILKDDQTL 77 Query: 470 GSW 462 S+ Sbjct: 78 ESY 80 >EOX97451.1 Ubiquitin family protein isoform 1 [Theobroma cacao] Length = 624 Score = 89.0 bits (219), Expect = 6e-17 Identities = 46/66 (69%), Positives = 54/66 (81%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SWKECD 450 S+ +CD Sbjct: 80 SY-DCD 84 >XP_007199777.1 hypothetical protein PRUPE_ppa003711mg [Prunus persica] ONH92478.1 hypothetical protein PRUPE_8G178100 [Prunus persica] Length = 555 Score = 88.6 bits (218), Expect = 8e-17 Identities = 45/62 (72%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNGSKFSVR++L STV DFK +LAQNCD A+QQRLIYKGRILKDDQTL Sbjct: 20 INIRCSNGSKFSVRASLDSTVGDFKAILAQNCDIP-----AEQQRLIYKGRILKDDQTLT 74 Query: 467 SW 462 S+ Sbjct: 75 SY 76 >XP_008235954.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like [Prunus mume] Length = 556 Score = 88.6 bits (218), Expect = 8e-17 Identities = 45/62 (72%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNGSKFSVR++L STV DFK +LAQNCD A+QQRLIYKGRILKDDQTL Sbjct: 21 INIRCSNGSKFSVRASLDSTVGDFKAILAQNCDIP-----AEQQRLIYKGRILKDDQTLT 75 Query: 467 SW 462 S+ Sbjct: 76 SY 77 >XP_008382427.1 PREDICTED: ubiquitin domain-containing protein DSK2a [Malus domestica] Length = 546 Score = 87.4 bits (215), Expect = 2e-16 Identities = 46/62 (74%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNGSKFSVR++L STV FK VLAQNC D+ ADQQRLIYKGRILKDDQTL Sbjct: 22 INIRCSNGSKFSVRASLDSTVGAFKEVLAQNC-----DTPADQQRLIYKGRILKDDQTLT 76 Query: 467 SW 462 S+ Sbjct: 77 SY 78 >XP_009345918.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like [Pyrus x bretschneideri] Length = 549 Score = 87.4 bits (215), Expect = 2e-16 Identities = 46/62 (74%), Positives = 50/62 (80%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNGSKFSVR++L STV FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 22 INIRCSNGSKFSVRASLDSTVGAFKEVLAQNCDIP-----ADQQRLIYKGRILKDDQTLS 76 Query: 467 SW 462 S+ Sbjct: 77 SY 78 >EOX97452.1 Ubiquitin family protein isoform 2 [Theobroma cacao] Length = 454 Score = 87.0 bits (214), Expect = 2e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >EOX97453.1 Ubiquitin family protein isoform 3 [Theobroma cacao] Length = 467 Score = 87.0 bits (214), Expect = 2e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_018841544.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X3 [Juglans regia] Length = 557 Score = 87.0 bits (214), Expect = 3e-16 Identities = 45/62 (72%), Positives = 50/62 (80%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNGSKF+VR+ L STV+ FK VLAQNC D ADQQRLIYKGRILKDDQTL Sbjct: 22 INIRCSNGSKFTVRTNLASTVSAFKAVLAQNC-----DVLADQQRLIYKGRILKDDQTLE 76 Query: 467 SW 462 S+ Sbjct: 77 SY 78 >XP_017971366.1 PREDICTED: ubiquitin domain-containing protein DSK2b isoform X3 [Theobroma cacao] Length = 557 Score = 87.0 bits (214), Expect = 3e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_017971365.1 PREDICTED: ubiquitin domain-containing protein DSK2b isoform X2 [Theobroma cacao] Length = 558 Score = 87.0 bits (214), Expect = 3e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_017971363.1 PREDICTED: ubiquitin domain-containing protein DSK2b isoform X1 [Theobroma cacao] Length = 559 Score = 87.0 bits (214), Expect = 3e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNG+KF+VR++L STVA FK VLAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_012833787.1 PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X2 [Erythranthe guttata] Length = 536 Score = 86.3 bits (212), Expect = 5e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSV ++L TVADFKG+LAQNC D A+QQRLIYKGRILKDDQTL Sbjct: 19 VNIRCSNGSKFSVNTSLELTVADFKGLLAQNC-----DVTAEQQRLIYKGRILKDDQTLV 73 Query: 467 SW 462 S+ Sbjct: 74 SY 75 >XP_012833786.1 PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Erythranthe guttata] EYU40473.1 hypothetical protein MIMGU_mgv1a004204mg [Erythranthe guttata] Length = 539 Score = 86.3 bits (212), Expect = 5e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSV ++L TVADFKG+LAQNC D A+QQRLIYKGRILKDDQTL Sbjct: 19 VNIRCSNGSKFSVNTSLELTVADFKGLLAQNC-----DVTAEQQRLIYKGRILKDDQTLV 73 Query: 467 SW 462 S+ Sbjct: 74 SY 75 >XP_010111710.1 hypothetical protein L484_006581 [Morus notabilis] EXC31549.1 hypothetical protein L484_006581 [Morus notabilis] Length = 553 Score = 86.3 bits (212), Expect = 5e-16 Identities = 45/63 (71%), Positives = 51/63 (80%) Frame = -2 Query: 650 PINVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTL 471 P+NVRCSNGSKF+VR++L STV FK +LAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 21 PVNVRCSNGSKFTVRTSLESTVEAFKALLAQNCDVP-----ADQQRLIYKGRILKDDQTL 75 Query: 470 GSW 462 S+ Sbjct: 76 LSY 78 >OMO92019.1 hypothetical protein COLO4_17934 [Corchorus olitorius] Length = 557 Score = 86.3 bits (212), Expect = 5e-16 Identities = 45/70 (64%), Positives = 54/70 (77%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 IN+RCSNG+KF+VRS+L STV FK +LAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 24 INIRCSNGTKFTVRSSLESTVGSFKALLAQNCDIP-----ADQQRLIYKGRILKDDQTLQ 78 Query: 467 SWKECDVDNF 438 S+ + + N+ Sbjct: 79 SYDKIFLLNY 88 >XP_004153821.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X2 [Cucumis sativus] KGN43333.1 hypothetical protein Csa_7G024070 [Cucumis sativus] Length = 546 Score = 85.9 bits (211), Expect = 7e-16 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSV ++L STVA FK +LAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGSKFSVTTSLDSTVATFKSILAQNCDIP-----ADQQRLIYKGRILKDDQTLV 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_008447852.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X2 [Cucumis melo] Length = 547 Score = 85.9 bits (211), Expect = 7e-16 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSV ++L STVA FK +LAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGSKFSVTTSLDSTVATFKSILAQNCDIP-----ADQQRLIYKGRILKDDQTLV 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81 >XP_004153820.1 PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X1 [Cucumis sativus] Length = 551 Score = 85.9 bits (211), Expect = 7e-16 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = -2 Query: 647 INVRCSNGSKFSVRSTLGSTVADFKGVLAQNCDDQTLDSYADQQRLIYKGRILKDDQTLG 468 +N+RCSNGSKFSV ++L STVA FK +LAQNCD ADQQRLIYKGRILKDDQTL Sbjct: 25 VNIRCSNGSKFSVTTSLDSTVATFKSILAQNCDIP-----ADQQRLIYKGRILKDDQTLV 79 Query: 467 SW 462 S+ Sbjct: 80 SY 81