BLASTX nr result
ID: Panax24_contig00004060
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00004060 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAF01844.1 At2g44120/F6E13.25 [Arabidopsis thaliana] CDX95588.1 ... 102 4e-26 XP_013624003.1 PREDICTED: 60S ribosomal protein L7-3-like, parti... 102 1e-25 ABR25893.1 60S ribosomal protein l7-1, partial [Oryza sativa Ind... 102 1e-25 XP_019098793.1 PREDICTED: 60S ribosomal protein L7-2 [Camelina s... 102 2e-25 KVI02892.1 Ribosomal protein L30, ferredoxin-like fold domain-co... 101 2e-25 XP_018856160.1 PREDICTED: 60S ribosomal protein L7-2-like, parti... 102 2e-25 BAT04445.1 Os08g0234000 [Oryza sativa Japonica Group] 102 3e-25 XP_017248729.1 PREDICTED: 60S ribosomal protein L7-4 [Daucus car... 105 5e-25 EYU18200.1 hypothetical protein MIMGU_mgv1a026225mg [Erythranthe... 104 6e-25 XP_012856346.1 PREDICTED: 60S ribosomal protein L7-2-like isofor... 104 7e-25 XP_011017700.1 PREDICTED: 60S ribosomal protein L7-2-like [Popul... 104 7e-25 XP_019174070.1 PREDICTED: 60S ribosomal protein L7-2 [Ipomoea nil] 104 7e-25 XP_019197001.1 PREDICTED: 60S ribosomal protein L7-2-like [Ipomo... 104 7e-25 XP_018860023.1 PREDICTED: 60S ribosomal protein L7-2 [Juglans re... 102 7e-25 XP_010518538.1 PREDICTED: 60S ribosomal protein L7-2-like, parti... 102 8e-25 XP_012856344.1 PREDICTED: 60S ribosomal protein L7-2-like isofor... 104 8e-25 XP_002489056.1 hypothetical protein SORBIDRAFT_0199s002010 [Sorg... 99 9e-25 XP_002324681.1 hypothetical protein POPTR_0018s13700g [Populus t... 104 2e-24 KVH93091.1 Ribosomal protein L30, conserved site-containing prot... 103 2e-24 XP_019198866.1 PREDICTED: 60S ribosomal protein L7-4 [Ipomoea ni... 103 2e-24 >BAF01844.1 At2g44120/F6E13.25 [Arabidopsis thaliana] CDX95588.1 BnaC03g24690D [Brassica napus] Length = 54 Score = 102 bits (254), Expect = 4e-26 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRE+F+NEL+RRMN Sbjct: 7 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 54 >XP_013624003.1 PREDICTED: 60S ribosomal protein L7-3-like, partial [Brassica oleracea var. oleracea] Length = 99 Score = 102 bits (254), Expect = 1e-25 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRE+F+NEL+RRMN Sbjct: 52 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 99 >ABR25893.1 60S ribosomal protein l7-1, partial [Oryza sativa Indica Group] Length = 89 Score = 102 bits (253), Expect = 1e-25 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNRED++NELIRRMN Sbjct: 42 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 89 >XP_019098793.1 PREDICTED: 60S ribosomal protein L7-2 [Camelina sativa] Length = 119 Score = 102 bits (255), Expect = 2e-25 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRE+F+NELIRRMN Sbjct: 72 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 119 >KVI02892.1 Ribosomal protein L30, ferredoxin-like fold domain-containing protein [Cynara cardunculus var. scolymus] Length = 80 Score = 101 bits (251), Expect = 2e-25 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 F EANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 33 FNEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 80 >XP_018856160.1 PREDICTED: 60S ribosomal protein L7-2-like, partial [Juglans regia] Length = 105 Score = 102 bits (253), Expect = 2e-25 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNRED++NELIRRMN Sbjct: 58 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 105 >BAT04445.1 Os08g0234000 [Oryza sativa Japonica Group] Length = 117 Score = 102 bits (253), Expect = 3e-25 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNRED++NELIRRMN Sbjct: 70 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 117 >XP_017248729.1 PREDICTED: 60S ribosomal protein L7-4 [Daucus carota subsp. sativus] KZM94773.1 hypothetical protein DCAR_018015 [Daucus carota subsp. sativus] Length = 241 Score = 105 bits (261), Expect = 5e-25 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN Sbjct: 194 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 241 >EYU18200.1 hypothetical protein MIMGU_mgv1a026225mg [Erythranthe guttata] Length = 233 Score = 104 bits (260), Expect = 6e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 186 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 233 >XP_012856346.1 PREDICTED: 60S ribosomal protein L7-2-like isoform X2 [Erythranthe guttata] EYU21221.1 hypothetical protein MIMGU_mgv1a012680mg [Erythranthe guttata] Length = 243 Score = 104 bits (260), Expect = 7e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 196 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 243 >XP_011017700.1 PREDICTED: 60S ribosomal protein L7-2-like [Populus euphratica] XP_011017701.1 PREDICTED: 60S ribosomal protein L7-2-like [Populus euphratica] ABK93172.1 unknown [Populus trichocarpa] Length = 244 Score = 104 bits (260), Expect = 7e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 197 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 244 >XP_019174070.1 PREDICTED: 60S ribosomal protein L7-2 [Ipomoea nil] Length = 245 Score = 104 bits (260), Expect = 7e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 198 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 245 >XP_019197001.1 PREDICTED: 60S ribosomal protein L7-2-like [Ipomoea nil] Length = 246 Score = 104 bits (260), Expect = 7e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 199 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 246 >XP_018860023.1 PREDICTED: 60S ribosomal protein L7-2 [Juglans regia] Length = 148 Score = 102 bits (253), Expect = 7e-25 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNRED++NELIRRMN Sbjct: 101 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 148 >XP_010518538.1 PREDICTED: 60S ribosomal protein L7-2-like, partial [Camelina sativa] Length = 175 Score = 102 bits (255), Expect = 8e-25 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRE+F+NELIRRMN Sbjct: 128 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 175 >XP_012856344.1 PREDICTED: 60S ribosomal protein L7-2-like isoform X1 [Erythranthe guttata] Length = 248 Score = 104 bits (260), Expect = 8e-25 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 201 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 248 >XP_002489056.1 hypothetical protein SORBIDRAFT_0199s002010 [Sorghum bicolor] KXG18749.1 hypothetical protein SORBI_K020400 [Sorghum bicolor] Length = 54 Score = 99.0 bits (245), Expect = 9e-25 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNRE+++NELI+RMN Sbjct: 7 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYINELIKRMN 54 >XP_002324681.1 hypothetical protein POPTR_0018s13700g [Populus trichocarpa] EEF03246.1 hypothetical protein POPTR_0018s13700g [Populus trichocarpa] Length = 288 Score = 104 bits (260), Expect = 2e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 241 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 288 >KVH93091.1 Ribosomal protein L30, conserved site-containing protein, partial [Cynara cardunculus var. scolymus] Length = 226 Score = 103 bits (256), Expect = 2e-24 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPF+LKAPLGGLKKKRNHYVEGGDAGNREDF+NELIRRMN Sbjct: 179 FKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDFINELIRRMN 226 >XP_019198866.1 PREDICTED: 60S ribosomal protein L7-4 [Ipomoea nil] XP_019198867.1 PREDICTED: 60S ribosomal protein L7-4 [Ipomoea nil] Length = 242 Score = 103 bits (257), Expect = 2e-24 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -1 Query: 450 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDFVNELIRRMN 307 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRED++NELIRRMN Sbjct: 195 FKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNREDYINELIRRMN 242