BLASTX nr result
ID: Panax24_contig00003639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00003639 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004154290.1 PREDICTED: mitochondrial import receptor subunit ... 102 3e-26 OAY25470.1 hypothetical protein MANES_17G097600 [Manihot esculenta] 100 5e-25 XP_016539703.1 PREDICTED: mitochondrial import receptor subunit ... 100 5e-25 XP_002305407.1 Mitochondrial import receptor subunit TOM6 family... 100 5e-25 OAY29459.1 hypothetical protein MANES_15G146500 [Manihot esculenta] 99 7e-25 XP_015063655.1 PREDICTED: mitochondrial import receptor subunit ... 99 1e-24 XP_012458102.1 PREDICTED: mitochondrial import receptor subunit ... 99 1e-24 XP_012458101.1 PREDICTED: mitochondrial import receptor subunit ... 99 1e-24 XP_002519115.1 PREDICTED: mitochondrial import receptor subunit ... 99 1e-24 XP_006423157.1 hypothetical protein CICLE_v10029767mg [Citrus cl... 99 1e-24 XP_017981499.1 PREDICTED: mitochondrial import receptor subunit ... 99 1e-24 XP_016679716.1 PREDICTED: mitochondrial import receptor subunit ... 98 3e-24 KYP66034.1 hypothetical protein KK1_012314 [Cajanus cajan] 98 3e-24 XP_012069348.1 PREDICTED: mitochondrial import receptor subunit ... 98 3e-24 KHG18108.1 Mitochondrial import receptor subunit TOM6 -like prot... 98 4e-24 XP_015900822.1 PREDICTED: mitochondrial import receptor subunit ... 97 4e-24 XP_002313822.1 hypothetical protein POPTR_0009s11330g [Populus t... 97 4e-24 KVI01988.1 hypothetical protein Ccrd_019749 [Cynara cardunculus ... 98 4e-24 XP_004230848.1 PREDICTED: mitochondrial import receptor subunit ... 97 6e-24 XP_014493496.1 PREDICTED: mitochondrial import receptor subunit ... 97 8e-24 >XP_004154290.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] XP_008459248.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] XP_011649217.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] KGN61761.1 hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 102 bits (255), Expect = 3e-26 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQLR+HVAMFG WV VIRVTPY+LHYLSD+K+ELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >OAY25470.1 hypothetical protein MANES_17G097600 [Manihot esculenta] Length = 54 Score = 99.8 bits (247), Expect = 5e-25 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THV+MFG WV V+RVTPYILHYLSD+K ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVSMFGVWVAVVRVTPYILHYLSDEKDELKLEF 54 >XP_016539703.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] XP_016539705.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] Length = 54 Score = 99.8 bits (247), Expect = 5e-25 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THVA+FGAWVV IRVTPYILHY SD +ELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVALFGAWVVAIRVTPYILHYFSDHNEELKLDF 54 >XP_002305407.1 Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] ABK94088.1 unknown [Populus trichocarpa] EEE85918.1 Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 99.8 bits (247), Expect = 5e-25 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK ALKQL++HVAMFGAWVVV+RVTPY+LHYLSD+K ELKL+F Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >OAY29459.1 hypothetical protein MANES_15G146500 [Manihot esculenta] Length = 54 Score = 99.4 bits (246), Expect = 7e-25 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THVAMFG WV V+RVTPYILH+LSD+K ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVAMFGVWVAVVRVTPYILHFLSDEKDELKLEF 54 >XP_015063655.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum pennellii] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THV +FG WV VIRVTPYILHY SDQK+ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVTPYILHYFSDQKEELKLEF 54 >XP_012458102.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] XP_012458103.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] XP_016731271.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] XP_016731272.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] XP_016679715.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] XP_017614239.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] XP_017614240.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] KJB77893.1 hypothetical protein B456_012G163900 [Gossypium raimondii] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+ HVAMFG WV V+RVTPYILHYLSD+K+ELK++F Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDEKEELKIEF 54 >XP_012458101.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] XP_016731270.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] XP_017613195.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] KJB77892.1 hypothetical protein B456_012G163800 [Gossypium raimondii] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+ HVAMFG WV V+RVTPYILHYLSD+K+ELK++F Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIEF 54 >XP_002519115.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ricinus communis] EEF43326.1 conserved hypothetical protein [Ricinus communis] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+TH A+FGAWV +IRVTPY+LHYLSD K ELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >XP_006423157.1 hypothetical protein CICLE_v10029767mg [Citrus clementina] XP_006423158.1 hypothetical protein CICLE_v10029767mg [Citrus clementina] XP_006479354.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Citrus sinensis] XP_006479355.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Citrus sinensis] ESR36397.1 hypothetical protein CICLE_v10029767mg [Citrus clementina] ESR36398.1 hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFMKKPDK AALKQLR+HVAMFG WVVVIRVTPY+LHY S +K+ELKL+F Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHYFSREKEELKLEF 54 >XP_017981499.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Theobroma cacao] EOY16388.1 Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 99.0 bits (245), Expect = 1e-24 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+ HVAMFG WV V+RVTPYILHYLSD K+ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDDKEELKLEF 54 >XP_016679716.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] Length = 54 Score = 97.8 bits (242), Expect = 3e-24 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM KPDK AALKQL+ HVAMFG WV V+RVTPYILHYLSD+K+ELK++F Sbjct: 1 MFPGMFMPKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIEF 54 >KYP66034.1 hypothetical protein KK1_012314 [Cajanus cajan] Length = 54 Score = 97.8 bits (242), Expect = 3e-24 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLD 254 MFPGMFM+KPDK AALKQL++HVAMFGAWVVVIRVTPY+LH+LS +K+ELKLD Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGAWVVVIRVTPYVLHFLSAEKEELKLD 53 >XP_012069348.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Jatropha curcas] KDP46200.1 hypothetical protein JCGZ_10040 [Jatropha curcas] Length = 54 Score = 97.8 bits (242), Expect = 3e-24 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THVAMFG WV V+RV PYILHYLSD+K EL+L+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVAMFGVWVAVVRVAPYILHYLSDEKDELRLEF 54 >KHG18108.1 Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 76 Score = 98.2 bits (243), Expect = 4e-24 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLD 254 MFPGMFM+KPDK AALKQL+ HVAMFG WV V+RVTPYILHYLSD+K+ELK+D Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDEKEELKID 53 >XP_015900822.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ziziphus jujuba] XP_015902888.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ziziphus jujuba] Length = 54 Score = 97.4 bits (241), Expect = 4e-24 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMF++KPDKEAALKQLRTHVA+FGAWV VIRVTPY+LHYL +K+EL+L+F Sbjct: 1 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 54 >XP_002313822.1 hypothetical protein POPTR_0009s11330g [Populus trichocarpa] ABK93705.1 unknown [Populus trichocarpa] EEE87777.1 hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 97.4 bits (241), Expect = 4e-24 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPG+FMKKPDK ALKQLR+HVAMFGAWVVV+RVTPY+LHY+S +K ELKL+F Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >KVI01988.1 hypothetical protein Ccrd_019749 [Cynara cardunculus var. scolymus] Length = 69 Score = 97.8 bits (242), Expect = 4e-24 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDKEAALKQLR HVA+FGAWV IRVTPY+LHY SD K EL LDF Sbjct: 1 MFPGMFMRKPDKEAALKQLRVHVALFGAWVAAIRVTPYVLHYFSDSKDELVLDF 54 >XP_004230848.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] XP_006365492.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 97.1 bits (240), Expect = 6e-24 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLDF 251 MFPGMFM+KPDK AALKQL+THV +FG WV VIRV PYILHY SDQK+ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHYFSDQKEELKLEF 54 >XP_014493496.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vigna radiata var. radiata] XP_017432549.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vigna angularis] KOM50855.1 hypothetical protein LR48_Vigan08g168200 [Vigna angularis] Length = 54 Score = 96.7 bits (239), Expect = 8e-24 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -3 Query: 412 MFPGMFMKKPDKEAALKQLRTHVAMFGAWVVVIRVTPYILHYLSDQKQELKLD 254 MFPGMFM+KPDK AALKQL++HVAMFGAWVVVIRVTPY+LH+LS +K+ELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGAWVVVIRVTPYVLHFLSGEKEELKLE 53